SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005686 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005686
Domain Number 1 Region: 78-263
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.53e-49
Family Astacin 0.00025
Further Details:      
 
Domain Number 2 Region: 434-607
Classification Level Classification E-value
Superfamily TRAF domain-like 5.89e-40
Family MATH domain 0.00069
Further Details:      
 
Domain Number 3 Region: 271-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.18e-31
Family MAM domain 0.0044
Further Details:      
 
Domain Number 4 Region: 678-720
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000911
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005686   Gene: ENSBTAG00000004345   Transcript: ENSBTAT00000005686
Sequence length 752
Comment pep:known_by_projection chromosome:UMD3.1:23:20014170:20040232:1 gene:ENSBTAG00000004345 transcript:ENSBTAT00000005686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWTRLACIIPFILFFAHIAAVSINHLSKGNVYDGDFDEQKDISEINLDPHLAAGLDLFE
GDILLQNSRNGLRDPSSRWKFPIPYILADNLALNAKGAILYAFEMFRLKSCVDFKPYEGE
SSYIIFQEFSGCWSEVGDQHVGQNLSIGQGCDYKAIVEHEILHALGFYHEQSRTDRDDYV
NIWWDEILPGYQHNFNTYDDNFITDLNTPYDYESLMHYRPLSFNKNDSIPTITAKIPEFN
SIIGQRVDFSAIDLERLNRMYNCTTTHTFLDHCDFEKANICGMIQGTRDDTDWVHENNAQ
PGQADHTLAGQCTGAGYFMYLNTSFGAAEDAAMLESRILYPKRKQQCLQFFYKMSGSPSD
RLVVWIRRDDSTGNVRKLVKLKTFQGDFDHNWKIAHVTLREEKKFRYLFQGTKGDPQNSS
GGIYLDDITLTETPCPAGVWTVRNFSQVLQNTVKGDKLHSPRFYNSEGYGLGLTLYPQGR
TSSGSSGYLGLTFHLCSGENDAVLEWPVENRQVIMTILDQEADVRERMSSSMVFTTSKTQ
TSTAINGSVIWDRPSVVGSYDNSCECFRSIDWGWSAVISHQMLKRRSFLKNDDLIIFVDF
EDITHLNQTEVQVQNSRLTPQGLVLHCQEQPTSEEDSRKAPLEPALPSSLARGQSSRQKR
SVDNTGPLDHNWPQYFRDPCDPNPCQNEGICVNVKGMVSCRCTSGHAFFYTGERCQALQV
HSSVLGLLIGGVAGVVFLTFTVISILYQRSRQ
Download sequence
Identical sequences F1MSW0
ENSBTAP00000005686 ENSBTAP00000005686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]