SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005979 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005979
Domain Number 1 Region: 383-549
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.9e-19
Family G proteins 0.016
Further Details:      
 
Domain Number 2 Region: 17-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.21e-19
Family G proteins 0.0032
Further Details:      
 
Domain Number 3 Region: 137-237,279-336
Classification Level Classification E-value
Superfamily EF-hand 1.08e-18
Family Calmodulin-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005979   Gene: ENSBTAG00000004551   Transcript: ENSBTAT00000005979
Sequence length 587
Comment pep:known chromosome:UMD3.1:25:547440:552281:-1 gene:ENSBTAG00000004551 transcript:ENSBTAT00000005979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVPARAEEITIPADVTPEKVPTHIVDYSETEQTVEELQGEIDKADVVCVVYDVSEEATVE
KIRTKWIPLVNGDTKRGPRVPIILVGNKSDLRPGGSMEAVLPIMSQFPEIETCVECSAKN
LKNISELFYYAQKAVLHPTAPLYDPEAKQLRPACAQALTRIFRLSDQDMDQALSDQELNA
FQTSCFGHPLAPQALEDVKMVVSKNVVGGVRDDQLTLDGFLFLNTLFIQRGRHETTWTIL
RRFGYGDSLELTADYLCPPLRVPPGCSAELNHRGYQFVQRMFEKHDQDRDGALSPAELQS
LFSVFPAAPWGPHLPSTVRTKAGRLPLHGYLCQWTLVTYLDVRRSLEHLGYLGYPTLCEQ
DSQAHAITVTREKRLDQEKGQTQRNVLLCKVVGARGVGKSSFLRAFLGHSLGHQDAGEPS
VYAIDTVQVNGQEKYLILCEVAADSLLTASADASCDVACLMFDGSDLRSFALCASVYKQH
YMDGQTPCLFVCSKADLPGGVPLPGLSPAEFCRRHRLPTPTLFSCAGPVEPCMGIFTRLA
TMATFPHLVHGQLQATSFWLRVALGAMGAAVAAILSFSLYRVLVKSR
Download sequence
Identical sequences F1N6Q3
ENSBTAP00000005979 ENSBTAP00000005979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]