SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006317 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006317
Domain Number 1 Region: 621-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 565-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.08e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 510-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-24
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 398-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 677-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 9 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 10 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.44e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 11 Region: 173-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 12 Region: 930-987
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 13 Region: 818-875
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 14 Region: 874-931
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 15 Region: 761-819
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 16 Region: 117-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.77e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 17 Region: 972-1024
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-18
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 18 Region: 69-118
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000137
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 19 Region: 724-756
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000153
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006317   Gene: ENSBTAG00000008902   Transcript: ENSBTAT00000006317
Sequence length 1051
Comment pep:known chromosome:UMD3.1:18:47753215:47846224:-1 gene:ENSBTAG00000008902 transcript:ENSBTAT00000006317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHDLVMFRDVTVDFSQEEWECLNSNQRNLYRDVILENYSNLVSLGGCSISKPDVITLLE
QGKEPWMVVRDERIHASDKLLECKRCGKIFTCGADLRVHQRIHVGEKPYDCKECGKAFRV
RGQLNLHQRIHTGEKPYECKECGKTFRQYAHLTRHQRLNIAEKCYECKECGQAFLCSTGL
RVHHKLHTGEKPYDCKECGKAFRVRQQLTLHQRIHTGEKPYDCKECGKTFSRAYHLTLHQ
RIHTGEKPYECKECQKFFRRYSELISHQGIHIGEKPYDCKECGKAFRLFSQLTQHQSIHF
GEKPYKCKECEKNFRLLSQLTQHQSIHTGEKPYDCKECGKAFRLHSSLIQHQRIHSGEKP
YKCKECKKAFSFVSVLIRHQRIHTGEKPYECKECGKAFGSGANLAYHQRIHTGEKPYECN
ECGKAFGSGSNLTHHQRIHTGEKPYECKECGKAFSFGSGLIRHQIIHSGEKPYECKVCGK
SFSFESALTRHHRIHTGEKPYECKDCGKAFGSGSNLTQHRRVHTGEKPYECKGCGMAFSS
GSALTRHQRIHTGEKPYICNECGKAFSFGSALTRHQRIHTGEKPYVCKECGKAFNSGSDL
TQHQRIHTGEKPYECKECEKAFRSGSKLIQHQRMHTGEKPYECKECGKAFSSGSDLTQHQ
RIHTGEKPYECKECGKAFASGSKLIQHQLIHTGEKPYECRECRKSFSSGSALNRHQRIHT
GQKPYECKECEKTFGTGSTLTQHQRMHTAEKLYECKECGKAFICALQLIYHQRIHTGEKL
YECKDCQKAFICASQLTYHHQRVHTGEKPYQCKECGKAFNRGSLLTRHQKIHIGEKPFEC
KECAKTFICDSELTQHERIHTGKKPYECKECGKSFIRGSQLTHHQRIHTGEKLYVCKECR
MAFTQSSHLSQHQRLHTGKKPHECKQCGKAFNYDSQLIRHQRTHTGEKLYECEKCGKSFI
CGSHLTEHQRTHTGEKPFEGKECGKTFIRGSHLTQHQRIHTGEKPYECKECGKVFAYGSQ
LSQHQKIHTGNHMNRIHSGGKPYKCNAYGKD
Download sequence
Identical sequences F1MJ88
ENSBTAP00000006317 ENSBTAP00000026567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]