SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006638 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006638
Domain Number 1 Region: 5-346
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.29e-119
Family Calpain large subunit, catalytic domain (domain II) 0.000000109
Further Details:      
 
Domain Number 2 Region: 354-498
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 8.63e-38
Family Calpain large subunit, middle domain (domain III) 0.00013
Further Details:      
 
Domain Number 3 Region: 520-616
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.36e-16
Family Synaptotagmin-like (S variant) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006638   Gene: ENSBTAG00000005034   Transcript: ENSBTAT00000006638
Sequence length 640
Comment pep:known_by_projection chromosome:UMD3.1:15:57256223:57313832:1 gene:ENSBTAG00000005034 transcript:ENSBTAT00000006638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCVKPYENQNYSALKRACLRRKVLFEDPNFPATDDSLYYKGSPGPTVRWKRPKDICED
PRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPNAYAGI
FHFHFWRFGEWVDVVIDDRLPTVNNQLIYCHSSSRNEFWCALVEKAYAKLAGCYQALDGG
NTADALVDFTGGVSEPIDLTEGDFANDEAKRNQLFERVLKVHSRGGLISASIKAVTAADM
EARLACGLVKGHAYAITDVRKVRLGHGLLAFFKSEKLDMIRLRNPWGEREWNGPWSDTSE
EWQKVSKSEREKLGVTVQDDGEFWMTFEDLCRYFTDIIKCRLINTSYLSIHKTWEEARLR
GAWTRHEDPLQNRSGGCINHKDSFFQNPQYIFDVKKPEDEVLISIQQRPKQSTRRDGKGE
NLAIGFDIYKVEENRQYRMHSLQHRAASSIYINSRSVFLRTEQPEGRYVIIPTTFEPGHT
GEFLLRVFTDVPSNCRELRLDEPPRTCWSSLCGYPQQVTQVHVLGAAGLKDSPTGANSYV
IIKCEGDKVRSAVQKGTSTPEYDVKGVFYRKKPSQPITVQIWNHRVLKDEFLGQVHLKAN
ADDLQALHTLHLRDRNSRQPSDLPGTVAVRVLSSASLTAV
Download sequence
Identical sequences F1MQD1
ENSBTAP00000006638 ENSBTAP00000006638 XP_005216345.1.76553 XP_005216346.1.76553 XP_015330295.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]