SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007194 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007194
Domain Number 1 Region: 802-890
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000034
Family Myosin rod fragments 0.008
Further Details:      
 
Domain Number 2 Region: 674-741
Classification Level Classification E-value
Superfamily EF-hand 0.0000342
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007194   Gene: ENSBTAG00000005469   Transcript: ENSBTAT00000007194
Sequence length 916
Comment pep:known_by_projection chromosome:UMD3.1:8:70414190:70429165:1 gene:ENSBTAG00000005469 transcript:ENSBTAT00000007194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQFKRQRINPLPGGRNFSGAASTSLLGPPPGLLTPPVATDLSQNARHLQGGEKQRVFTG
IVTSLHDYFGVVDEEVFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVKVQTLSNQP
LLKSPAPPLLHVAALGQKQGILGAQPQLIFQPHRIPPLFPQKPLSLFQTSHTLHLSHLNR
FPARGPHGRLDQGRSDDYDSKKRKQRAGGEPWGAKKPRHDLPPYRVHLTPYTVDSPVFDF
LELQRRYRTLLVPSDFLAVHLSWLSAFPVSQPFSLHHPSRIQVSSEKEPAADAGAEPPPT
DSDPTYSSKVLLLSSPGLEELYRCCMLFVDDMAEPRETPEHPLKQIKFLLGWKDDEAVLV
GGEWSPSLDGLDPKGDPQVLVRTATRCAQAQAGIDLSACTKWWRFAEFQYLQAGPPRRLQ
TVVVYLPDIWTIMPTLEEWEALCQQKAAEAAPPPPEVPVETEPTEQPADGSEQAADTSKS
AENPEVTAQQEVDTDLPEAPPPPLEPAVMARSRCVNLSLQSIVEDRRPKERISFEATVLA
ELFLEMLQRDFGYRIYKTLLSLPEKVVAPPEPEKEEAAKEEEAVKEEAKESKDEVQSEGT
AAEADAPPKEDGLLPKPPSSGGEDEEKPRGEASEDLCEMALDPELLLLRDDGEEEFAGAK
LEDSEVRSVASNQSEMEFSTLQDMPKELEPSAVLPVDCLLAFVYFDANWCGYLHRRDLER
ILLTLGLRLSAEQAKQLVSRAVSQNICQYRSLQYSRPEGPDGALPEDLLFGNLDLLPPPG
KSGKPGTTPVEHKGLVSHNGSLINVGNLLQRAEQQDSGRLYLENKIHTLELKLEESHNRF
SATEVTNKTLATEMQDLRARLAEAEEMARTAERQKNQLQRLLQEFRRRLTTLQLDTQRML
EKADSWVEKEEPAPSN
Download sequence
Identical sequences E1B9H3
9913.ENSBTAP00000007194 ENSBTAP00000007194 NP_001068766.2.59421 NP_001068766.2.76553 XP_005210285.1.76553 XP_019821882.1.53367 XP_019821883.1.53367 ENSBTAP00000007194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]