SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008009 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008009
Domain Number 1 Region: 573-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000389
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 610-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000135
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 90-120
Classification Level Classification E-value
Superfamily SET domain 0.00000837
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 132-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000771
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008009   Gene: ENSBTAG00000006095   Transcript: ENSBTAT00000008009
Sequence length 707
Comment pep:known chromosome:UMD3.1:9:50873669:50881408:-1 gene:ENSBTAG00000006095 transcript:ENSBTAT00000008009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDES
GGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFD
IPIIATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVLSSGGGRAYLHHEHAARQG
AAPAADGLRLSPKPPASDFAAAAPASTLRPHPQVPPAPQACGARESIKREASSAPSATSP
TLAKWGPSKKGKEQPDRALDMSGPARGHGHFLGIVGGSPAGGGGLAFYPGVRSAFKPTGL
ARAAAAAHGDPYRDEGGGKPGAGLALSRLLGGGRAGGHPRSGENPAAGGAGHHHHHHAHH
HHHPKCLLAGDPPPPPGLPCSGALRGFPLLSGPPEEASAFKHVERAPPAAADVPGVRYAQ
LPPAAGLPLERCSLPPLDAGGLKGYPGGECSHLPAVMPAFTVYNGELLYGSPAAAAYYPL
KLHFGGLLKYPESISYFSGPAAAAALSPAELGSLASIDREIAMHTQQLSEMAAGKGRSRL
DAGTLPPAVVAAGGAGGGGSGGGSGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKP
LKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQNLLP
KASDGPGAEPHYPPEPGEPKSDNDSDVDVCFTDDQSDPEAGGGGERD
Download sequence
Identical sequences F1MMF1
ENSBTAP00000008009 ENSBTAP00000008009 NP_001179939.1.59421 NP_001179939.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]