SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008931 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008931
Domain Number 1 Region: 37-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.53e-73
Family Calponin-homology domain, CH-domain 0.0000181
Further Details:      
 
Domain Number 2 Region: 1262-1414
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-28
Family Spectrin repeat 0.00061
Further Details:      
 
Domain Number 3 Region: 299-420
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-28
Family Spectrin repeat 0.00041
Further Details:      
 
Domain Number 4 Region: 2846-2994
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-27
Family Spectrin repeat 0.00028
Further Details:      
 
Domain Number 5 Region: 2521-2676
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-26
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 1571-1705
Classification Level Classification E-value
Superfamily Spectrin repeat 1.67e-25
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 2116-2249
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-23
Family Spectrin repeat 0.00075
Further Details:      
 
Domain Number 8 Region: 3266-3420
Classification Level Classification E-value
Superfamily Spectrin repeat 3.43e-22
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 9 Region: 594-734
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-22
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 10 Region: 1691-1829
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-21
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 11 Region: 3052-3206
Classification Level Classification E-value
Superfamily Spectrin repeat 2.03e-21
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 12 Region: 2309-2463
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-20
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 863-997
Classification Level Classification E-value
Superfamily Spectrin repeat 8.46e-19
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 14 Region: 2652-2775
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-17
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 15 Region: 1887-2042
Classification Level Classification E-value
Superfamily Spectrin repeat 5.69e-17
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 16 Region: 697-812
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-16
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 17 Region: 1101-1210
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000684
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 18 Region: 1485-1588
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000149
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 19 Region: 3394-3488
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000072
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 20 Region: 416-529
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000017
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 21 Region: 2048-2142
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000403
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 22 Region: 953-1097
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000158
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 23 Region: 1420-1516
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000013
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 24 Region: 504-594
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000691
Family Spectrin repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008931   Gene: ENSBTAG00000006790   Transcript: ENSBTAT00000008931
Sequence length 3657
Comment pep:known_by_projection chromosome:UMD3.1:10:37355715:37405210:-1 gene:ENSBTAG00000006790 transcript:ENSBTAT00000008931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LASEPHNPQQFLGTTGHLKQESSRRPQAGSPGPVLMDSAYEMGHIRKLQARHMQMQEKTF
TKWINNIFQHGRVGIEIQNLCTELADGTHLLRLLELISGEALPPPNRGRMRVHFLENNSR
ALAFLRAKVPIPLIGPENIVDGDQTLILGLIWVIILRFQISDICLDKEEFGVSAALLSAR
EALLVWCQRKTAGYANINITDFSRSWSDGLGFSALIHAHRPDLLDYSSLRPDRPLHNLRC
AFHVAEQELGIAQLLDPEDVAALQPDERSIMTYVSLYYHHFSRLHQEQTVQRRLHQILLQ
LQESEALQTQYKELVADLLCWIAEKQVQLEARDFPDNLPAMRQLLVAFASFRSQEKPPRL
QQRGATEALLFRLQTVLQAQNRRPFLPPEGLGPAELSRCWTSLERAEASRSRALQQRLLQ
LERLETLARRFQRKAALRESFLTDTEQVLDRAAAPLASRAMLEAAAQRLGMLEASILPQE
GRFQALAEIADILHQERYHGGTEVASRQLEITQRWERLLQRLQGQRKQIAGMQAVLSLLQ
EVETASDQLNELQVLVSSMACGQKLTEVERLLQRHELLEAQISALGAHVSHLAHQTMKLD
SSMGTAVEVLQAKARALAQLYQSLMSLARSRRASLEQTLQQAELLHSCEEEEAWLREHGQ
LVEDASPGPDLSQIAAALQKHKALEAELHRHQAVCADLVQRGCKLGACGPPTGPDPWERA
EVVQGMWQRLWARMDEQGMRLQAALLVQQYFVDVAEADSWLQEQRSTLESASFGQDQVAT
EALLRQHLHLERSVRAFGTELRRLDEQAQVATAQAALLAQVVSALSSPKIGPRNPGAWRE
VFCHSGLWRTQKMTLPDEPDPGFDPNTILQTQDRLNQDYEGLRAQAERRRAQLEEAVALF
DFYGSCGELQSWLTKQTTLLQMLQPEANNLEVMQLKYENFLTALAVGRGLWTEVNSSAEQ
LKQRCPGGSPQIQLQQEELSQRWEQLEALKKEKETQLVCTTHVCSFLQECGSTRVQLQNL
VLQLESLELGNSEDGHHVLRVGQQKMLVLEKYIRHLQRAASKVEEMAPAESPSLQAHVET
LQGLLERVREQVAQRAKARAHRSFLQESERLLLCADSIQAKLHSEEEAVDVASAQRLLGK
HRDLLEEIHLQQERLQQLETQGQPMAASGSPDFREAASTLRLLGHQGQELKAAWEQRQQQ
LQEGLELQKFGRDVDGFTASCANHEAFLQLDVLQEGVVEAQSLMQKHQECGRLLDALGSR
AEDLRARGKKLAQSRHPAAHKVREQLQSIQEQWTRVQERSEQRRRQLLASLQLQEWKQDV
VEVMLWMEEKGRVLVDEPSREPSNIMRKLRRHEAATCELAATRGHVEGLQQVGRELLSSR
PHAQEDVQARLQGLSSKWEDLRCKMAERGKQLQQARQQDQLLRLLQEAKEKMEQLEGTVQ
RAEVGQDLGSSQGLQKQHCQLEAESQALASKMAALVPEARQAISSQAIMEETQKYLQRFK
ALQGHLASRRRQLQASVELYHFHHLSNAELMWVAEHMPTPSASSAKCPDGAHRLLHKHKE
LRVQVRAHQGQVRWVLGSGRYLAASGHPQAQHIMERCQELEGRWADLEQACEAQARHLQQ
AAALQECFLDASELEDWVEEKWPLVSSQDYGGDETATIRLIKKHQALQQELARCWNSVEE
LDRRAQTLTGPEGPAQLGVVQKRLRERLQALQELAATRDRELEGTLKLHEFMREAEDLQG
WLASQKQVAGRGESLGEDYEDVLHLCTKFFRFQRTVEMGGQRVASCQQLAEKLLERGHRA
APRAHQMQQDLQAAWSELWELTQARGRLLRDAEATLKVHRDMLEALTQVQEKTTSLPCDV
AQDLRGLEPQLRRHEGLERELMGIDQQLQELLEMGGTVQKLGPGPQAHAVQQRQQALVQA
WETLKLRAEQRRAQLERAWLLARFHMAVRDYTSWVASVWQDLQVEAGSQEPGSGPLKLSA
HQQLRAMLEAREELYQQAAQLGQQALLAAGTCITEVRDRLQALRDKRERVFQAWEQKQER
LQAMGQEQLFLRKCGRLDEILKAREVLLKTSALGSSVEEVEQLIRKHETFQKVLAAQEEK
EAALCEQVKMLGGPRAQDLLCTVLERRARVKELVESRRHALHTSLMVAAFIRAATQAKDW
IQEQLQQLKEPVPSGDLKAKLRHLQKHQAFEAEVQAHEEIITSVVKEGEALLAHSHPLVG
EVSQRLRELQEHWEKLRQAVALRGEDLEDKRNILEFLQRVDTAEAWIQEMEVMVNVSDLG
QDREHCQQLHRQLRKLRGVWAGDTVDDARIRSISDFSPQLKTQDTEQLKTIRQRQQQLNN
RWNSFHGNLLRYQQQLEVALEIHTLSQKLDDITQQVRKKAALVQALDCGKDLDNVQRLKQ
KHKELEQEMGLLQAQVEPLDREAGRVCQRSPEVAHGLSHQQQEMMDSWRQLQSRIQKWKE
SLDALQQAQELQAVLRELLVWAQRLRAQLDSRRSPGSLVEAQHMLEEHQELKAELDSRMD
SISLARSTGQQLLAAGHPSTPNIRQALADFNQELNSLEGAWHEHQLHLHQALELQRVLSS
VEQMESWLSSLEACPASEGLGDCLANVETLLWKHRVREQDLEAQAEKMSALEAASRSLLQ
GGHPEAQGTLSRCQAMLLRKEALLERARTRCCQLEELRQLQSFLQDSCEMAAWLREKNLV
ALEEGWWDPVDLQAQLQQQQHLQAELDTRAHHQQRLQMEGQRLLQDGHLASETIQERLQE
LRKLWEELQAQSQRRAAKLQEAREALRLRRSMEELESWLEPVELKLRVPIGGQDQPGLDE
LLGDQGELEAAVDRQVGRAQALLGQAQAQACVQEGHCLARDVEEQAQRLLQRFESLRAPL
QERRTALEARSLLLQFFRDAEEEMAWVQEKLLLVAARDCGQSPSALRRLQEKHQSLESEM
SSHEALTRAVVGTGRKLVQAGHFAARDVAARVQQLEDAMGRLRAEAAQRRRRLQQAQEAQ
YFLTELLEAESWLEERGCGLDIEDMGQSAEATQAFLRQLEATRRDLEGFSTRIERLQQTA
ALLESGQNPESPKVLAQMHAVRDAHSGLLQRVESRGQGLKEQLQLHQLEREALLLDAWLA
SKVATAESQDYGQDLEAVKLLEEKFDAFRKDVQSLGQARVQALRERAGSLERAAPRCSPQ
IQAQRSRIEASWERLDQAVKARTQNLAAAREVRGLEQAAAKLQARMQKKATLVARDAFNL
SLSSVQTLQQQHRCLERELAAMEKEVAQVQTEACRLGQLYPAAQEGLAKQLAGVQEAWAT
LNAKVHEQDRQLEKAAEGHAFLGRCRELLAWATEKQALVSSEELAGDIARAEGLLALHEK
LGREIKEYCLQAQNVQQEGQRLVDSGHCMSLEVTGCLQDLDRQLRALREAWALRRERCEE
SWRLQKLRQELDQAEAWLACREGLLLDPNCGHSLSDVELLLCRHKDLEKLLASQEEKFAR
LQQEAEVEQKQQVKGLKPLRSWWPRAQLTETGDQQDAKGVPTTEGILELKQQLLPGRRQQ
GAGPSSSLWFPWTTPGSPLPVGTMVQSSSLPGSLWTHTQVQNTASTASLDLVGVQREKPG
DHHDGKHTFSLRLTAGETLSAAPSAGQTGSWRGTLSSWTAPSLSPELKARPSGFLAE
Download sequence
Identical sequences E1BJV1
ENSBTAP00000008931 ENSBTAP00000008931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]