SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009376 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009376
Domain Number 1 Region: 637-832
Classification Level Classification E-value
Superfamily Sec7 domain 1.05e-72
Family Sec7 domain 0.0000017
Further Details:      
 
Domain Number 2 Region: 412-588,1092-1493,1651-1758
Classification Level Classification E-value
Superfamily ARM repeat 4.39e-28
Family Armadillo repeat 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009376   Gene: ENSBTAG00000007120   Transcript: ENSBTAT00000009376
Sequence length 1788
Comment pep:known chromosome:UMD3.1:13:77822894:77903223:1 gene:ENSBTAG00000007120 transcript:ENSBTAT00000009376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAEIEKQRLGAAAPPKA
NFVEADKYFLPFELACQSRSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVE
TICNCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMENQVLQEARELEKPIHSKPQSPVIQAAAGSPKFNRLKQSQAQS
KPTTPEKTDLTNGEHARSGSAVITENGHAPRERGPSLSERTRPSGEPGTEDGAQEVVKEI
LEDVVTSAVKEAAQKHGLTEPERVLSELECQERAAPPAADENSQTNGIADDRQSLSSADN
LESDAQGHPVAARFSHILQKDAFLVFRSLCKLSMKPLGEGPPDPKSHELRSKVVSLQLLL
SVLQNAGPVFRTHEMFITAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHLKM
QIEVFFKEIFLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFER
LVNDLSKIAQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTSLG
QERPVDQEMGDLARRSSVTSMESTVSSGTQTTVQDDPEQFEVIKQQKEMIEHGIELFNKK
PKRGIQYLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGESMKFNKEVMYAYVDQLDF
CEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSII
MLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIAMKETKEHTI
ATKSTKQSVASEKQRRLLYNLEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKLV
WTPLLAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLERDAYVQALARFSLLTAS
SSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKTRYLSGS
GREREGSLKGHTLAGEEFMGLGLGNLVSGGVDKRQMASFQESVGETSSQSVVVAVDRIFT
GSTRLDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSRIWHV
IGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSP
TIRDMVIRCIAQMVNSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTGHIVTTIFQ
HHFPAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPRVLQEYTSDDMN
VAPGDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWQDLFRI
VFRIFDNMKLPEQQSEKSEWMTTTCNHALYAICDVFTQFYETLNEVLLSDVFAQLQWCVK
QDNEQLARSGTNCLENLVISNGEKFSPDVWDETCNCMLDIFKTTIPHVLLTWRPVGMEDD
PAEKHLDVDLDRQSLSSIDKNASERGQSQLSNPTDDGWKARPYANQKLFASLLIKCVVQL
ELIQTIDNIVFYPATSKREDAEHMAAAQQDTLDTDIHIETEDQGMYKYMSSQHLFKLLDC
LQESHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMYVDENRRD
SWEEIQQRLLSVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKINDEKFKAHASMYYP
YLCEIMQFDLIPELRAVLRKFFLRIGVVYKIWIPEEPSQVPGSLSPIW
Download sequence
Identical sequences E1BKI9
ENSBTAP00000009376 ENSBTAP00000009376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]