SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009654 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009654
Domain Number 1 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 203-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.27e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-20
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 4 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 384-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000053
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 173-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000122
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009654   Gene: ENSBTAG00000007340   Transcript: ENSBTAT00000009654
Sequence length 445
Comment pep:known_by_projection chromosome:UMD3.1:27:5024117:5031818:1 gene:ENSBTAG00000007340 transcript:ENSBTAT00000009654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLTFEDVAVDFTQEEWSLLDKSQKNLFRNVMMETIHHLVSVGYQISKSDGLCPSNKGSQ
PWAIASAAPGHSSKDLYTFNGQARMAFNQAKMFQRFLKHTHMEDLVFIYISIFSKIYILS
IYLGSERPLRQQEMILMPSVYRKHISPAMAMGHSLIYRVTFTLEKEHERIHTEKAFRNYS
NLSSQKKIHTGEKPFKCQLCGKVFSQSCSLKDHKRTHTGEKPYKCPLCGKAFSRCTSLSK
HKRIHTGKKPFECRLCGRFSLKEHEKAHRGENGYECHQCEKVFSHCSKLIQHKESHTGEK
PFKCQLCGKAFNQNFSLKQHEKSHTEEKTYKCHQCWKVFSRCASLKRHSMIHTGEKPFKC
QLCGKVFNQNSSLKGHERTHTGEKPCECHQCGKAFPQRRDLNSHNKIHTGEKPYLCLECG
KFFHYSSGLCMHKKIHTGVKARLPC
Download sequence
Identical sequences G3X6N6
ENSBTAP00000009654 ENSBTAP00000009654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]