SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009798 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009798
Domain Number 1 Region: 456-743
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-53
Family Eukaryotic proteases 0.0000206
Further Details:      
 
Domain Number 2 Region: 188-456
Classification Level Classification E-value
Superfamily vWA-like 5.98e-51
Family Integrin A (or I) domain 0.0000117
Further Details:      
 
Domain Number 3 Region: 83-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000107
Family Complement control module/SCR domain 0.00031
Further Details:      
 
Domain Number 4 Region: 150-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000153
Family Complement control module/SCR domain 0.00046
Further Details:      
 
Domain Number 5 Region: 23-98
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000347
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009798   Gene: ENSBTAG00000007450   Transcript: ENSBTAT00000009798
Sequence length 750
Comment pep:known chromosome:UMD3.1:23:27231726:27243367:-1 gene:ENSBTAG00000007450 transcript:ENSBTAT00000009798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLMAVLCLLPLYPGLATAALSCPKNVNISGGSFTLSNGWNPGSILTYSCPLGHYPYPV
VTRLCKSNGQWQIPRSTRSTKAICKPVRCPAPVSFENGVYIPRLGSHPVGGNLSFECEDG
FTLRGSAVRQCRPNGMWDGETAVCDNGASHCPNPGISVGAVRTGSRFGLGDKVRYRCSSN
LVLTGSAERECQDDGVWSGTEAICRQPYSYDFPEDVAPALGTSFSHLLATTNPIQQKKKQ
NLGRKIQIQRSGHLNLYLLLDASQSVSKDDFEIFKDSASRMVDRIFSFEIKVSVAIITFA
SKPKIIMSVLEDRSRDVTEVENSLRNINYKDHENGTGTNIYEALHAVYIMMNNQMNRPHM
NPGAWQEIRHAIILLTDGKSNMGGSPKVAVDNIKEVLNINQKRKDYLDIYAIGVGSLHVD
WKELNNLGSKKDGERHAFILKDVQALSQVFEHMLDVSQLTDPICGVGNMSANASAQERTP
WHVTIKPKSQETCRGALISDQWVLTAAHCFRNAEDRTLWRVSVGDPNFQGSKEFQIEEAV
ISPGFNVFSKKSQGIPEFYGDDIALLKLTQKVKMSTHARPICLPCTVGANLALRKLPGST
CRDHEKELLNQVSIPAHFVALNGDKLNINLKTGSEWTNCVKVVLEDKTTFPNLTDVREVV
TDQFLCSGTQGDDSPCKGESGGAVFLERRLRFFQVGLVSWGLYNPCGGSSKNSRKPAPHG
KVPRDFHINLFRLQPWLRQHLEGILNFVPL
Download sequence
Identical sequences A0A0A0MP91
ENSBTAP00000009798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]