SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010955 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010955
Domain Number 1 Region: 196-342
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.05e-43
Family Dual specificity phosphatase-like 0.00000108
Further Details:      
 
Domain Number 2 Region: 7-138
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.75e-20
Family Cell cycle control phosphatase, catalytic domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010955   Gene: ENSBTAG00000008319   Transcript: ENSBTAT00000010955
Sequence length 380
Comment pep:known_by_projection chromosome:UMD3.1:X:39785475:39788263:1 gene:ENSBTAG00000008319 transcript:ENSBTAT00000010955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLS
VRALLPGPPLQPPPPAPVLLYDQGGGRHRRTEAEAEEWEADSVLGTLLQKLREEGYLAYY
LQGGFSRFQAECPHLCETSLDRRGGPSMAPLPSPVVGLGGLCLGSDCSDVDSEPDRDAMS
CGLDSEGATPPPAGLLPSFPVQILPNLYLGSARDSANVESLAKLGIRYILNVTPNLPNLF
EKNGDFHYKQIPISDHWSQNLSQFFPEAIAFIDEALSQNCGVLVHCLAGVSRSVTVTVAY
LMQKLHLSLNDAYDLVKRKKSNISPNFSFMGQLLDFERSLQLEERRARERGSGGQESAAS
DPPSFFTTPTSDGVFELDAT
Download sequence
Identical sequences F1MEZ2
ENSBTAP00000010955 ENSBTAP00000010955 NP_001179956.1.59421 NP_001179956.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]