SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011320 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011320
Domain Number 1 Region: 445-683
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.3e-34
Family Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA 0.043
Further Details:      
 
Domain Number 2 Region: 55-190,222-333
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.86e-28
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011320   Gene: ENSBTAG00000008583   Transcript: ENSBTAT00000011320
Sequence length 759
Comment pep:known chromosome:UMD3.1:28:26876456:26894874:1 gene:ENSBTAG00000008583 transcript:ENSBTAT00000011320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTASTAQQTVSASAPFEGLQDGGSMDGRHSLSVHSFQTTGLHNSKAKSIIPNKVAPVV
ITYNCKEEFQIHDELLKAHYTLGRLSDATPEHYLVQGRYFLVRDVTEKMDTLGTLQSCGA
PNFRQVQGGLAVFGMGQPSLSGFRQVLQKLQKDGHRECVIFCVREEPVLFLRAAEDFIPY
TPRDKQNLHENLQGLGPGVQAERLELAIRKEIHDFAQLSENKYYVYHNTEDLRGEPHAVA
IRGEDDVHVTEEVFKRPLFLQPSYRYHRLPLPEQGAPLETQFDAFVSVLRETPSLLLLQD
AHGPPPALLFSCQTGVGRASLGMVLGTLLLFHRGGTALRPEAAPMKTKPLSMEQLEVVQS
FLHMVPEGRRMVEEVDRAIAACAELHDLKEVVLGSQRELEGSRAQDFPPYKVWGSSSQHG
VQQRALQSLERYFYLILFNYYLHEQYPLAFALSFSRWLCVHPELYRLPVILSSAGPVAPK
DLIALGSLVADDLVSPDALSTIREMDVANFRRVPRLPIYGMAQPSAKALGSVLAYLTDSK
RKLQQVMWVNLREEAVLECDGRTHSLRWPGPPMAPDQLENLETQLKAHLTRPPPDADGPQ
THRFQTCLTMQEVFSQHHGACPGLTYHRIPVPDFCAPREEDFDRLLGALQAALAKDPGTG
FVFSCLSGQGRTTTAMVVAVLAFWHIRGFPEVGEEELVSVPDAKFTKGEFEVVMKVVQLL
PDGHRVKREVDAALDTVSETMTPMHYHLREIIICTFRQV
Download sequence
Identical sequences E1BH07
ENSBTAP00000011320 ENSBTAP00000011320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]