SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011767 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011767
Domain Number 1 Region: 265-535
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.46e-82
Family Protein kinases, catalytic subunit 0.000000000096
Further Details:      
 
Domain Number 2 Region: 152-296
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-39
Family SH2 domain 0.00000117
Further Details:      
 
Domain Number 3 Region: 70-162
Classification Level Classification E-value
Superfamily SH3-domain 3.61e-25
Family SH3-domain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011767   Gene: ENSBTAG00000008938   Transcript: ENSBTAT00000011767
Sequence length 542
Comment pep:known_by_projection chromosome:UMD3.1:13:66985878:67004791:1 gene:ENSBTAG00000008938 transcript:ENSBTAT00000011767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNKSKPKDASQRRRSLESAENTHGGGGGGGGGGGAFPSSQTPSKPASSDGHRGPNTAF
APAAAEPKLFGGFNSSDTVTSPQRAGPLSGGVTTFVALYDYESRTETDLSFKKGERLQIV
NNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGT
FLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYS
KHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR
VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLK
GETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGESLVCKVADFGLARLI
EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREV
LDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGE
NL
Download sequence
Identical sequences E1BIM8
ENSBTAP00000011767 ENSBTAP00000011767 9913.ENSBTAP00000011767 NP_001104274.1.59421 NP_001104274.1.76553 XP_005896063.1.15283 XP_010809813.1.76553 XP_010827484.1.44457 XP_010827485.1.44457 XP_010827486.1.44457 XP_010827487.1.44457 XP_010827489.1.44457 XP_010827490.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]