SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012184 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012184
Domain Number 1 Region: 666-750
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000733
Family Canonical RBD 0.0031
Further Details:      
 
Domain Number 2 Region: 1905-1959
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000164
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 
Domain Number 3 Region: 989-1071
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000228
Family Canonical RBD 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012184   Gene: ENSBTAG00000009242   Transcript: ENSBTAT00000012184
Sequence length 1965
Comment pep:known_by_projection chromosome:UMD3.1:11:13155560:13235444:-1 gene:ENSBTAG00000009242 transcript:ENSBTAT00000012184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPRFNPRGNFPLQRPRAPNPSEMRPPGPFMRPGSMGLPRFYPAGRARGIPHRFACHES
YQNMEPQRMNVQVTQHQTDPRLTKEKLDFHEAQQKKEKPHGSRWDDEPHISASVGVKQSS
VTQVTEQSPKVQSRYTKESASSILASFGLSNEDLEELSRYPDEQLTPENMPLILRDIRMR
KMGRRLPNLPSRSRNKETLGNEAVSSNVIDYGHASKYGYTEDPLEVRIYDPEIPTDEVED
EFRSQPSISASVPAPNVMCNSMFPVEDVFRQMDFPSESSSNQSFFPVESGSKMSGLHISR
GQSVLEPVKSVSQSISQTVNQTMSQSLIPPPMNQQPFSSELISTVSQQERIPREPVINSS
NVHGSGGSKKNYQSEADIPIRSPFGIVKASWLPKFSHADAQKMKRLPTPSMMNDYYAASP
RIFPHLCSLCNVECSHLKDWIQHQNTSTHIESCRQLRQQYPDWNPEILPSRRNEGNRKEN
ETPRRRSHSPSPRHSRRSSSSHRFRRSRSPVRCMYRPRSRSPRICHRFIPRYRSRSRSPY
RMRNPFRGSPKCFRSVSPERTSRRSERSSDRKKALEDVIQRSGHESEFSKQKHPEAVDKG
HSPAQKLKTGSGAKTSVKSTSSAKSDSNIGGHCTRYKSKNLEDDTPSESKQMADKTVSLQ
RKLRKDQSSHYGPVLLISELPEDGCSEEEIRKIFQPFGKVNDVLIVPYRKEAYLEMEFKE
AITAVMEYIETTPLLIKGKSVKVCVPGKKKSQNKEMKKKMSDSKKTSASTLKKDTDASTA
VETVTAASATKTGQTKTSATKVNKSSGKSAGSVKSVVTVAAKGNKASIKTAKSSGKKSLE
VKKAGIVKNKDISKSVNVPESSEMKTNVEVKTTENGAKETISGSKDIVVNKINKISLVSF
TTVSLVIPLYSVIISWRSNLIRLFFVLVISILKAFIEINRKSADSMIKFYTCFPISMDGN
QLSISMAPENMNLKDEEAIFTTLIRENDPEVNIDKIYDRFVHLDNLPEDGLQCVLCVGLQ
FGKVDHHVYMSNKNKAILQLDSPVSAQSMYSFLKQNPQNIGDHVLTCTLSPKMDSSEVKA
EKDPELGKESPDLKNSPVDESEVQTTADSPSIKPSEVEEESVPSVQTGTFIQQKEPFEEE
PEKTLCVSDFALETVEVETQGEEVKVEIPLVASTSASIDLFTENVGESVLNQQVYTGDFE
KEETEIINPETELSTSDNTFIEERNIKGILEDSPSEADFFSGITESMIEAVAEVDKQETV
SEIVPSTCVVALVPGISTGDEQAVSTKGISEKTNMDEKEENELNTKEARMDLKTGREKAE
KNDRMVTEKLDKVVAAVKEKPAENSVTKACPNKTVVQANKPDETSKISMLVASNASSSKS
GIKADVVSSTKARATASKSENQKSFLKSVLRDQINAEKRLSAKESGLLKPTSARSGVAEN
SSKLKPIQSGVTRGSSGRISALQGKDSKLDYRDVTKQPQETEAKPSIMKRDDSNNKTLTG
QNTKNPKNTTGRSSKSKEEPLFPFNLDEFVTVDEVIEEVNPFHVKQNPLKGKRKEALKNT
PSSELNLKKKKGKISAPRVVEGELSFVTLDEIGEEEDAAAQLAQALVTVDEVIDEDDINV
EDMVKNSNSLLTLDELIDQDDCISHSETKDVTVLSVAEEQDLLKQERLVTVDEIGEVEEL
PLNESADISFGALNTKGDEGNTGRDSLGFISSQMPEDPSTLVTVDEIQDDSSDLHLVTLD
EVTEEDEDSLADFNNLKEELNFVTVDEVGEEEDGDNDLKIELTQRKNDHPTDKRGDRKKR
TVDKKKTKLEALSQVGPVNENVMEENPKTMIERRSAATVPTKRVRIGKMPPSEKVVTVEP
VKDEEAFQISEGGGESGLEDSEPEQKRKKIEDSSGRSVAPDVPEDLDFLVPKAGFFCPIC
SLFYSDEKAMTNHCKSTRHKQNTEKFMAKQRKEKEQNEAEERSSR
Download sequence
Identical sequences E1BJV5
ENSBTAP00000012184 ENSBTAP00000012184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]