SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013422 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000013422
Domain Number - Region: 183-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0614
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013422   Gene: ENSBTAG00000010174   Transcript: ENSBTAT00000013422
Sequence length 247
Comment pep:known chromosome:UMD3.1:3:7112318:7115084:1 gene:ENSBTAG00000010174 transcript:ENSBTAT00000013422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENFSLLSISGTRISSSALSTLPDIMSSRATSLPDIAKPVLPTEVPSPVQALPPQCPGGV
LRHGVHNIVISPDCILGDAPNGEQLRWNCTIYRPWFSPYSYFLCKDKESHLETYSFSEVQ
RDEGQRDSCLPEDTADSVCSSSPSPENTCPREATKKSRPGPDTTDSITFQDILMASKWHP
AQQNGYKCASCCRLYPTLHSLKSHIKRGFKEGFSCKVYYHKLKTLWYKEQKARPGDRLSL
GSGQAFR
Download sequence
Identical sequences Q2YDE2
NP_001039925.1.59421 NP_001039925.1.76553 ENSBTAP00000013422 ENSBTAP00000013422 9913.ENSBTAP00000013422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]