SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013714 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013714
Domain Number 1 Region: 296-367
Classification Level Classification E-value
Superfamily EF-hand 0.000000144
Family Polcalcin 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013714   Gene: ENSBTAG00000010387   Transcript: ENSBTAT00000013714
Sequence length 445
Comment pep:known chromosome:UMD3.1:13:30604489:30684245:-1 gene:ENSBTAG00000010387 transcript:ENSBTAT00000013714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELTKELMELVWGTNSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAF
LLKKLLFSSEKSSWRDCPEEERKELLCHTLCDILESAGCDNSGSYCLVSWLRGKTTEETA
SLSGSPAQSSCQVEHSSALAVEELGFERFHALIQKRSFRSLAELRDAVLDQYSMWGNKFG
VLLFLYSVLLTKGIENIKNEIEDSSEPLIDPVYGHGSQSLINLLLTGHAVSNVWDGDREC
SGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSETHLTVFFAKDMALVA
PEAPSEQARRVFQTYDPEDNGFIPDSLLEDVMKALDLVSDPEYINLMKNKLDPEGLGIIL
LGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYVEGTAVVMGFEDPLLQTDDTP
IKRCLQTKWPYIELLWTTDRSPSLN
Download sequence
Identical sequences Q0IIH8
ENSBTAP00000013714 NP_001069575.1.59421 NP_001069575.1.76553 XP_005688031.2.57651 XP_005974646.1.78601 XP_010858271.1.44457 XP_011978773.1.54773 XP_019828659.1.53367 9913.ENSBTAP00000013714 ENSBTAP00000013714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]