SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014097 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014097
Domain Number 1 Region: 66-175
Classification Level Classification E-value
Superfamily L domain-like 1.15e-16
Family Ngr ectodomain-like 0.00059
Further Details:      
 
Domain Number 2 Region: 202-290
Classification Level Classification E-value
Superfamily Immunoglobulin 7.01e-16
Family I set domains 0.043
Further Details:      
 
Domain Number 3 Region: 283-383
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000328
Family I set domains 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014097   Gene: ENSBTAG00000010647   Transcript: ENSBTAT00000014097
Sequence length 476
Comment pep:known chromosome:UMD3.1:8:79336288:79504460:1 gene:ENSBTAG00000010647 transcript:ENSBTAT00000014097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSWTRWHGPAMARLWGFCWLIVGFWRAALACPTSCKCSASRIWCGDPSPGIVAFPKLEA
TSADPENITEIYIANQKRLEIINEDDLEAYVGLKNLTIVDSGLKSVAHKAFLKNSNLQHI
NFTRNKLTILSRKHFRHLDLSELILVGNPFTCSCDVMWIKTLQETKPSPETQDLYCLDEN
SKNISLANLQIPHCGLPSANLAAPNLTVEEGKSITLSCTVAGDPVPNLYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYK
LVAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNKSNGTLPT
GVVDTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIPLDG
Download sequence
Identical sequences Q0VCN4
NP_001068693.1.59421 NP_001068693.1.76553 XP_005210434.1.76553 XP_019822061.1.53367 ENSBTAP00000014097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]