SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014350 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014350
Domain Number 1 Region: 892-949
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 1060-1117
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 724-781
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 612-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-24
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 5 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 6 Region: 668-725
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-24
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 7 Region: 1004-1061
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-23
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 8 Region: 190-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 246-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.25e-23
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 11 Region: 948-1005
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 12 Region: 780-837
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.33e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 13 Region: 836-893
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.49e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 14 Region: 10-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-21
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 15 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.96e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 16 Region: 1102-1154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-20
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 17 Region: 414-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 18 Region: 557-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-17
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 19 Region: 155-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000145
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 20 Region: 519-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000524
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014350   Gene: ENSBTAG00000034090   Transcript: ENSBTAT00000014350
Sequence length 1158
Comment pep:novel chromosome:UMD3.1:18:60599037:60640035:-1 gene:ENSBTAG00000034090 transcript:ENSBTAT00000014350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPAKPPNHDQGRLTFQDVAIDFTQEEWECLDPGQRKLYRDVMVENYRNLASLGLVSKVDL
VTFLELLKDPRNMRRMETTAIYPAMSPQDTQDMMPKNPALEDVFPKANLGMYQTFHLRNL
NLMKDWEYTRISSIHSKIYNVDDNDAVQNAQEENKCKICEKVFSKSSNLSRHRRIHTGGK
PFKCRECSRAFNCHSLLTQHQRIHSGEKPYICKECNKAFRSSSFLTEHQRIHTGEKPYKC
TVCGKAFTYNSSLIKHQRIHAGEKPHKCTECSKAFTYNSLLIQHRQIHTGEKPYKCTECG
KAFTYNSRLIQHQQIHAREKPYKCTECSKAFTYNSLLIQHQRIHTGEKPYKCTECSKAFP
YNSSLIQHQRIHTGEKPYKCTECSKAFIYNSLLIQHWRIHTGEKPYKCTECRKAFTYNSL
LIKHRRIHTGEKPYKCSECSKVFTCNSDLIEHQRIHTGEKKPYICKKCNKAFHHCSVLAQ
HHRIHTGEKPYKCKECGKAFLRSSALTQHHEIHTGDRRYKCTECGKAFGYNSTLSENQQM
HTAEKPYKCREFGKACNQNSTLTPHQRTHTGKKLHKCKELCGKAFMYNSRLIQHQQIHAG
EKPYKCTDCSKAFTYNSLLIQHRRIHTGEKPYKCTECSKAFTYNSHLIQHQRIHTGERPY
KCTECSKAFTYNSLLTQHRRIHTGEKPYKCTECSKAFIYNSLLIQHQRIHTGEKPFKCTE
CSKAFTCNSDLIEHKRIHTGEKPYICKECNKAFRRSSFLTEHQRIHTGEKPYKCTVCGKA
FTYNSRLIQHQRIHAEEKPYKCTECSKAFTRKSVLIKHRQIHTGEKPYKCTECSKAFTYN
SRLIEHQQIHAGEKPYKCTECSKAFTYNSLLIKHRRIHSGEKPYKCTECSKAFPCNSDLI
EHQRIHTGEKPYICKECNKAFRRSSFLTRHQRIHAGEKPYKCTVCGKAFTYNSSLIQHQR
IHTGEKHYKCTECSKAFTCNSLLIQHQQNHTGEKPYKCTVCGKAFTYNSRLIKHQRIHAG
EKPYKCTECSKAFTYNSLLIQHRRIHTGEKPYKCTECSKTFTYNSRLIQHQRIHSGEKPY
KCTECSKAFTCNSSLIQHQRIHTGEKPYICKECNKAFHRSSFLTQHQRIHTGEKPYKCTE
CGKAFTYHSNLIQHKRIH
Download sequence
Identical sequences G3X6V5
ENSBTAP00000014350 ENSBTAP00000014350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]