SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015189 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015189
Domain Number 1 Region: 220-503
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.29e-110
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000491
Further Details:      
 
Domain Number 2 Region: 507-793
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.57e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015189   Gene: ENSBTAG00000011425   Transcript: ENSBTAT00000015189
Sequence length 803
Comment pep:known_by_projection chromosome:UMD3.1:13:52600919:52771800:-1 gene:ENSBTAG00000011425 transcript:ENSBTAT00000015189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSMDSWFLLTLLGSGLIHVGASNTTTVSPSVGVTRSVKASTTESLKEETKTSNPTPSVTS
SLTPTFSPNLTLGPVYVTTVNSSDSDNGTTRTVSTNSVVTTISPNGTWLPDNQFTDTRTE
PWEGNASTAATTPETFPPSGNSDSKDRRDETPIIAVMVALSSLLVIVFIIIVLYMLRFKK
YKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNK
LFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINAS
FINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGC
WTYGNIRVSVEDVTVLVDYTVRKFCIQQVGDVTNRKPQRLITQFHFTSWPDFGVPFTPIG
MLKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRA
QRCQMVQTDMQYVFIYQALLEHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKK
LTSIKIQNDKMRTGNLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQ
KDSYIASQGPLFHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDIT
VELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQ
QQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLE
QYEFCYKVVQEYIDAFSDYANFK
Download sequence
Identical sequences E1BPA0
ENSBTAP00000015189 ENSBTAP00000015189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]