SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015220 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015220
Domain Number 1 Region: 67-198
Classification Level Classification E-value
Superfamily FKBP-like 1.91e-38
Family FKBP immunophilin/proline isomerase 0.0004
Further Details:      
 
Domain Number 2 Region: 177-292
Classification Level Classification E-value
Superfamily FKBP-like 8.05e-37
Family FKBP immunophilin/proline isomerase 0.00022
Further Details:      
 
Domain Number 3 Region: 292-403
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-31
Family FKBP immunophilin/proline isomerase 0.0004
Further Details:      
 
Domain Number 4 Region: 3-78
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-23
Family FKBP immunophilin/proline isomerase 0.00083
Further Details:      
 
Domain Number 5 Region: 422-487
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000321
Family Calmodulin-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015220   Gene: ENSBTAG00000011454   Transcript: ENSBTAT00000015220
Sequence length 501
Comment pep:known chromosome:UMD3.1:19:42650885:42655321:1 gene:ENSBTAG00000011454 transcript:ENSBTAT00000015220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYDRHTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYGSIGVSGLIPPDATLY
FDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDSDFVRYHYNGTLLDGTAFDTSYSKGGTY
DTYVGSGWLIKGMDQGLLGMCPGERRKIVIPPFLAYGEKGYGTVIPSQASLVFHVLLIDV
HNPKDTVQLETLELPPGCVRRAVAGDFMRYHYNGSLMDGTLFDSSYSRNHTYNTYVGQGY
IIPGMDQGLQGSCMGERRRITIPPHLAYGENGTGDKIPGSAVLIFDVHVIDFHNPADPVE
IKTLSRPLETCNETAKLGDFVHYHYNCSLLDGTRLFSSHDYGAPQEATLGAHKVIEGLDT
GLQGMCVGERRQLVVPPHLAHGESGARGVPGSAVLLFEVELVSREDGLPTGYLFVWHEDP
PAHLFEHMDLNKDGEVPVEEFSTFIKAQVSEGKGRLLPGQDPEKTIGDMFQNQDRNQDGK
ITAEELKLKSDEDQDRVHEEL
Download sequence
Identical sequences G3X6W8
ENSBTAP00000015220 ENSBTAP00000015220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]