SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015385 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015385
Domain Number 1 Region: 182-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 3.66e-59
Family Dystroglycan, domain 2 0.000000386
Further Details:      
 
Domain Number 2 Region: 497-597
Classification Level Classification E-value
Superfamily Cadherin-like 8.16e-19
Family Dystroglycan, N-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-18
Family Dystroglycan, N-terminal domain 0.00000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015385   Gene: ENSBTAG00000011580   Transcript: ENSBTAT00000015385
Sequence length 895
Comment pep:known_by_projection chromosome:UMD3.1:22:51187154:51200326:-1 gene:ENSBTAG00000011580 transcript:ENSBTAT00000015385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSVGSSLPLPLWGRTFLLLLSVAVTQSHWPSEPSEAVRDWENQLEASMHSALSDLHET
VPTVVGIPDGTAVVGRSFRVTIPTDLIASNGEVIKVSAAGKEALPSWLHWDPQSHTLEGL
PLDTDKGVHYISVSAARLGANGSHVPQTSSVFSIEVYPEDHSEPQSLRAASPDPGEVVSL
VCAADEPVTVLTVILDADLTKMTPKQRIDLLRRMRGFSEVEPHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCALNQNSVPDIRGVEVPAREGAMSAQLGYPVVGWHIA
NKKPSLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPSQIRPTMTIPGYMEPTAVITPP
TTTTKKPRVSTPRPATPSTDSSTTTTRRPTKKPRTSRPVPRVTTKAPITRLETASPPTRM
RTTTSGVPHGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQ
GDKAPARFKAKLTGDPAAVTNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWT
NNTLPLEPCPKEQITALSRRIAEDDGKPRGAFVNALEPDFQAMSITVTGSGSCRHLQFVP
VAPPMRVPSEAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT
PLNQDTVGEYAPLRDEDPSAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences F1N7D7
ENSBTAP00000015385 ENSBTAP00000015385 XP_005222762.1.76553 XP_005222763.1.76553 XP_005222764.1.76553 XP_015315021.1.76553 9913.ENSBTAP00000015385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]