SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015473 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015473
Domain Number 1 Region: 371-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.45e-48
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.001
Further Details:      
 
Domain Number 2 Region: 305-378
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 3.57e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.015
Further Details:      
 
Domain Number 3 Region: 5-85
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000262
Family Domains B1 and B5 of PheRS-beta, PheT 0.0091
Further Details:      
 
Domain Number 4 Region: 218-281
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000068
Family B3/B4 domain of PheRS, PheT 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015473   Gene: ENSBTAG00000011649   Transcript: ENSBTAT00000015473
Sequence length 589
Comment pep:known chromosome:UMD3.1:2:111504465:111578408:-1 gene:ENSBTAG00000011649 transcript:ENSBTAT00000015473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVSVKRDLLFRALGRTYTDEEFDELCFEFGLELDEITSEKEIISKEQGNEKAHGASDV
VLYKIDVPANRYDLLCLEGLVRGLQVFKERIKTPMYKRVMPKGEIQKLIITEETAKIRPY
AVAAVLRNIKFTKDRYDSFIELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKKPSD
IKFKPLNKSKEYTACELMNIYKTDNQLKHYLHIIENKPLYPVIYDSKGVVLSMPPIINGN
HSKITVNTKNVFIECTGTDFTKAKIVLDVIVTTFSEYCENQFTVEAAEVVFPNGKLHTFP
ELAYRKEMVRADLINKKVGIRETPENLAKLLTRMCLKSEVIGDGNQIEVEIPPTRADIIH
ACDIIEDAAIAYGYNNIQMTLPKTYTIANQFPLNKLTELLRQDMAAAGFTEALTFALCSQ
EDIADKLGMDISATKAVHISNPKTAEFQVARTTLLPGLLKTLAANRKMPLPLKLFEISDI
VIKDSSRDVGARNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEKKGGYAIKASEG
PVFFPGRCAEIFARGQSIGKLGVLHPDVITKFELTMPCSCVEINIEPFL
Download sequence
Identical sequences A8E4P2
NP_001098491.1.59421 NP_001098491.1.76553 XP_010835374.1.44457 ENSBTAP00000015473 ENSBTAP00000015473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]