SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015532 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015532
Domain Number 1 Region: 883-1165
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-70
Family Protein kinases, catalytic subunit 0.00000789
Further Details:      
 
Domain Number 2 Region: 574-872
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-44
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 3 Region: 372-437
Classification Level Classification E-value
Superfamily PH domain-like 0.000000123
Family Third domain of FERM 0.017
Further Details:      
 
Domain Number 4 Region: 464-552,581-607
Classification Level Classification E-value
Superfamily SH2 domain 0.000000223
Family SH2 domain 0.0097
Further Details:      
 
Domain Number 5 Region: 143-267
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000345
Family Second domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015532   Gene: ENSBTAG00000011698   Transcript: ENSBTAT00000015532
Sequence length 1185
Comment pep:known_by_projection chromosome:UMD3.1:7:16103271:16132860:-1 gene:ENSBTAG00000011698 transcript:ENSBTAT00000015532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLCQWRATTRGRKPSGDGAQPMATREGLKVLLHWAGPSGGEPWVTFTEPTLTAEDVCIH
VAHKVGITPPCFNLFALFDAQAQVWLPPNHILDTSRDSSLTLYFRMRFYFRNWHGTNPQE
PAVYRCGPPGAETSSEQAEQGVQLLDPASFEYLFEQGKHEFVNDVASLWELSSEEEIHHF
QNESLGMALLHLCHLALRNGVPLEKVAKKTSFKDCIPRSFRRQMRQHNALTRLRQRSIFR
KFLRAFQPGCLSQQVVMVKYLATLERLAPRFGTERVPVCHLELLSQADGEPCYIREGGQA
PPDPGSESAAGPPTHEVLVSGTEGIRWRLVPAEGPADGGAGGGSRMPDADPSGKKMKAEE
VGSEPVDRPRESPWSYFCDFQDITHMVLKERHVSIHCQDNKCLELTLPSRAAALSLVSLV
DGYFRLTADSNHYLCHEVAPPRLVMSIQDGIHGPLLEPFVLAKLKPEAGLYLIHWSTSHL
HRLILTVAQRDQAPGTKGLRLRKFPIELQAGTVMLEGWGRSFPSVRDLRAALQDCSLRAG
NDCFSLRRCCLPRPGEISNLIVTRGPQASTRPLNLSHLSFYRVRQEDITQLSHLGQGTRT
NVYEGLLRVGGGGPEEDKADGEEPPTPAGDRGQELRVVLKVLDPSHHDIALAFYETASLM
SQVSHVHLAFVHGVFVHGSENIMVTEYVEHGPLDVWLRRERGRVPLAWKLAVAQQLASAL
SYLEDKSLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLSALSREERVERIPWTAPE
CLSGGANSLSTAADKWGFGATLLEICFDGEAPLQGRSPSEKERFYQKQHKLPEPSCPELA
TLTSQCLTYEPAQRPSFRTILRDFTQLQPQNLADVLSVSPDSLASDPTVFHKRYLKKIRD
LGEGHFGKVSLYCYDPTNDGTGEMVAVKALKAGCGPQLRTGWRREIDILRKLYHKHIVKY
KGCCEDQGEKSIQLVMEYMPLGSLRDYLPRHNVGLVQLLLFSLQICEGMAYLHSQHYVHR
DLAARNVLLDNNRLVKIGDFGLTKAVPEGHEYYCVREDGDSPVFWYAPECLKECKFYYAS
DVWSFGVLMYELLTYCDSSQSPPSKFIELIGLTQGQMTVLRLTELLERGERLPQPEKCPS
EIYCLMKDCWKAEASFRPTFQNLVPILRSYHEKYQGQAPSVFSVC
Download sequence
Identical sequences F1MCX4
ENSBTAP00000015532 NP_001107236.1.59421 NP_001107236.1.76553 ENSBTAP00000015532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]