SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015724 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015724
Domain Number 1 Region: 405-577
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.26e-32
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.036
Further Details:      
 
Domain Number 2 Region: 159-234,338-401
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.39e-29
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.064
Further Details:      
 
Domain Number 3 Region: 54-132
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000121
Family Canonical RBD 0.0052
Further Details:      
 
Domain Number 4 Region: 5-46
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000019
Family Classic zinc finger, C2H2 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015724   Gene: ENSBTAG00000011846   Transcript: ENSBTAT00000015724
Sequence length 871
Comment pep:known chromosome:UMD3.1:29:41625200:41634609:-1 gene:ENSBTAG00000011846 transcript:ENSBTAT00000015724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVDSDIEPLPRGGFRCCLCHITTANQPSLDAHLGGRKHRHLVELRATRKAQGLRSVFV
SGFPRDVDSTQLSEYFQAFGPVASVVMDKDKGVFAIVEMGDLGAREAVLSQPQHSLGGRR
LRVRPREQKEFQSPASRSPKRVAPDSHQLIKALAEAPDVEAQMVKLVGLRELSEAERQLR
SLVVALMQEVFAEFFPGCVVHPFGSSINSFDVHGCDLDLFLDLGDLDEPQPAPKAPESPS
LDSALASPLDPQALACTPASPPDSQPPASPQDSEALDFEAPSSSLAPRTPDSALASETLA
SPQSLPPASPLQEDQGDGDQGKAVELAEALKGEKAEGGAMLELVGSILRGCVPGVYRVQT
VPSARCPVVKFCHRPSGLHGDISLSNRLALHNSRFLSLCSELDGRVRPLVYTLRCWAQGR
GLSGSGPLLNNYALTLLVIYFLQTRDPPVLPTVSQLTQKAGEQVEVDGWDCSFPRDASRL
EPSTNKEPLSSLLAQFFSCVSCWDLRGSLLSLREGQALSVAGGLPSNLSEGLRLGPMNLQ
DPFDLSHNVAANVTSRVAGRLQNCCRAAANYCRSLQYQRRSSRGRDWGLLPLLQPSSPSS
ILSATPIPLPPASFTQLTAVLAQVLREALGCHIEQGTKRLRSEGGGPGEPPQGGTSKRAK
LDGQKKSCEEGPEEQQGCAGEHGEDGVEEMVIEVGESVQDWVMRSPGQLGELPLMTGKHL
ATREEGQSGTAALAKQGPRGPEAACEGSQAEAEKRVSLTVSWRCALWHRVWQGRRRARRR
LQQQIKEGGGSGAGSGAEWLATEAQVTRELRGLSSTEQRPEAEPLLTFVASTSQADQSLT
VTPLQDSQGLFPDLHHFLQVFLPQALRNLLK
Download sequence
Identical sequences F1MG03
ENSBTAP00000015724 ENSBTAP00000015724 9913.ENSBTAP00000015724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]