SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016407 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016407
Domain Number 1 Region: 754-982
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.51e-59
Family DBL homology domain (DH-domain) 0.00000000115
Further Details:      
 
Domain Number 2 Region: 349-525
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-53
Family Regulator of G-protein signaling, RGS 0.0000000309
Further Details:      
 
Domain Number 3 Region: 985-1119
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-44
Family Pleckstrin-homology domain (PH domain) 0.000000265
Further Details:      
 
Domain Number 4 Region: 37-120
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-20
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016407   Gene: ENSBTAG00000012361   Transcript: ENSBTAT00000016407
Sequence length 1562
Comment pep:known_by_projection chromosome:UMD3.1:3:13887504:13970875:1 gene:ENSBTAG00000012361 transcript:ENSBTAT00000016407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLMCFSYSFSRLSSLSLGDSAPERKSPSHHRQPSDTSETTGLVQRCVIIQRDQHGFGFTV
SGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLG
SSPSSVGVSGPQQDPAPAGAPRVTPVVPPPPPPPPLPPPQRITGPRPLQDPEFQKHATQI
LRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDILPVYG
DTSQRSSEGRLSLDSQEGDSGLDSGTERFPSLSESLVNRNSVLSDAGLDSPRTSPVTMAR
LAQRHRRQGSDAPVPPSSDQGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDFEKLKSRP
AHLGVFLRYIFSQADPSPLLFYLCAEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKVPE
MLQAEIDLRLRSSEDVRAALCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLELDG
DPLHERQVAEKQLAALGDILSKYEEDRSGPMGFALNTYMSHAGIRLRETRPPNTAEKAQS
APDKDKWLPFFPKTKKQSSNSKKDKDALEDKKRNPILKYIGKPKTSSQSTFYIPLSPVEV
KPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESNSSRSEIRLGRSESLKGREE
MKRSRKAENVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPKMGRRSI
ESPNLGFCTDPLLPNLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVARLSQREIDRQEVIN
ELFVTEASHLRTLRVLDLIFYQRMKKEGLLPREELARLFPNLPELIEIHNSWCEAMRKLR
EEGPIIKEVSDLMLARFDGPAREELQEVAAQFCSYQSIALELIKTRQRKESRFQLFMQEA
ESHPQCRRLQLRDLIISEMQRLTKYPLLLENIIKHTEGGTSEHEKLCRARDQCREILKYV
NEAVKQTENRHRLEGYQKRLDTTSLERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDK
TLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLVRSVATDK
RAFFIICTSELGPPQIYELVALTSSDKNTWMELLEEAVRNATRLPGAAPTPIHPPPPGPQ
EPADQSPPPSRAGPDDSEVFRGEAEPGAAPGGMGCQQRVQGKPLALLADAEQEGSVEEEE
LGALPHSSASLDSKHRGSRTRDPILLPLPGPLFIEGLADAALEDVENLRHLILWSLLPGH
PTDPRAAGEPEDDLTPTPSFISITSHPWDPGSPGRAPAGTEGDTAPLLGPEWSQPGQEDT
TLRSLEQLPPRTRNSGIWESSELDKSPEEEASSTEGTGSYKVVRKAEVAGSKVVPALPES
GQAGPEPPEAEGGAKAGTGNCFYVSMPAGPPDSSTDPSGAHTSPSQPDGLPAWQTEPQPP
LQGGHGDQKHPSRSPPSLALRDVGMIFRTIEQLTLKLNRLKDMELAHRELLRSLRSQSSG
GTTPVGSFHTEAARWIESSLSPPAKEPPASDSTDSRELGPCPEDGPTPLEDSTADTAASP
GP
Download sequence
Identical sequences F1MZW2
ENSBTAP00000016407 ENSBTAP00000016407 9913.ENSBTAP00000016407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]