SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017105 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017105
Domain Number 1 Region: 288-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 400-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 344-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.73e-22
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 4 Region: 1-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.03e-20
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 5 Region: 445-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 240-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000379
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017105   Gene: ENSBTAG00000002370   Transcript: ENSBTAT00000017105
Sequence length 546
Comment pep:known_by_projection chromosome:UMD3.1:18:45886846:45891786:-1 gene:ENSBTAG00000002370 transcript:ENSBTAT00000017105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGCVTFEDVTIYFSPEEWGLLDEAQRLLYCDVMLENFALIASLGLASFRSHIVAQLEMGA
EPWVPDQADMTSAMARGVYRGLGSDFYCGTESEESPAELSVSVEVSQNMNSKAVSSTQKG
YPCNLCGLHLKDILYLAKHKFNAHFHQPQMQQNVDKSIGRNEGRALLVKSFRYDTSKKSF
TFRENGKASVARCGFLQHQVTTSVGEPEQSSESVVDFPTVQLHKKCSEFENAVSDKLSLV
QQRTHTGERSYECNKCGIFFSCAAGLFQHQRDHNRGKPYECGECGKFFSQHSSLIKHQRV
HTGESPHVCSECGKFFSRSSNLIQHKRVHTGEKPYECSECGKFFRQRSNLIHHKRIHTGK
SAHECSECGKSFNCNSSLIKHWRVHTGEKPYKCNECGKFFSRFDGLVQHQIVHTGERPYR
CSVCGKAFRRSSDLMNHQRVHTGERPYECSECGKTFRRSSNLRQHRKVHKPDKTYKCNEC
GKAFSQRSTLIQHQKIHAREKSTKDVLPPSAQQHLLEMNSESGLYEGAVSQKLNLVHPNI
YAGEIP
Download sequence
Identical sequences G3X713
ENSBTAP00000017105 ENSBTAP00000017105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]