SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017478 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017478
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.45e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 315-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 202-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 356-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 174-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000689
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017478   Gene: ENSBTAG00000010046   Transcript: ENSBTAT00000017478
Sequence length 509
Comment pep:known chromosome:UMD3.1:18:58212122:58220103:1 gene:ENSBTAG00000010046 transcript:ENSBTAT00000017478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQAQETLTFDDVAVDFTWEEWQLLAPAQKALYRDVMLENYSNLVSAGFQASTPEVLSKL
DQGEPWMMDDEIHCRTRSEVWKVDGHLLEHLQKKRVEKRLERWLEQNPLDNSGHQSRALF
RHNHDVFDLHGRSVTSNSSLLSESLNCEIKRPAEPPADGKSCPYADREPFHPELLSTKSQ
LMEHQHTKQMKKSHVCSECGKAFVKKSWLADHQNLHTGEKPHRCNLCGKAFFRKFQLTEH
QRMHMGDKPYECTDCGKTFLKKSGLNVHQRTHTGEKPFICSECGKGFIQKGNLVVHLRIH
TGEKPYTCTECGKGFTQKTCLMAHQRIHTGTSPFVCGECGKTLSQKMGLIKHQRTHTGEK
PFECSHCGKGFIEKPQLVIHQRIHTGEKPYRCSKCGKSFRGKSVLNKHLKTHSVKKLPPS
VKSPQSSVVLQEKNLNTVTMHLPPLAPQLPVGISGLLANRSTVLVGQPVTRWLPTGDNRG
LAQERTLMNSVNVVVPSVVNYILFYVTGN
Download sequence
Identical sequences G3X723
ENSBTAP00000017478 ENSBTAP00000017478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]