SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018336 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018336
Domain Number 1 Region: 678-974
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.86e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018336   Gene: ENSBTAG00000013798   Transcript: ENSBTAT00000018336
Sequence length 979
Comment pep:known chromosome:UMD3.1:2:107958895:107978251:-1 gene:ENSBTAG00000013798 transcript:ENSBTAT00000018336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPGRPGGPGGSGGLRVLLCLLLLGSRPGGCNAISAHGCLFDRRLCSHLEVCIQDGLFG
QCQVGVGQARPLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQYVISQEMERIPRLRPPE
PHPRDRSGLVPRRPGPAGELLLQGIPTGSAPALQHRLPRPSVGGGRAGAGSPLSPLQAEL
LPPLLEHLLLPPQPPHPALSYEPALLQPYLFHQFGSRDGSRGSESSPGMVSVDPLPKAEA
PAFLSRAGSKGMFGAHPGHSYGDPPGPPPAQLFQESELFYLAQESQVPSRTRAPRLPEPG
GSSRAGDSSEGYEEEGLEGREEKPPAPAEQPDVTLQRVAAVLAGYGVELHQLTPEQLSTL
STLLQLLPKGSRQNPGGAVNVGADIKKTMEEQVQGEDPAEPPPPMPSLPGSPTGSSTSNK
AQKELSTGASEPPKAAGPPATPVLVEKKSPLGQNQPTMAGQPSTRPSAEEYGYIVTDQKP
LSLAAGVRLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSE
LEAQTGLQILQTGVGQREEAAAILPRPAHSTSPMRSVLLTLVALAGVAGLLVALAVALCV
RQHARQRDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQ
FSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQ
AEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAY
IATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGSSLYHVYEVNLV
SEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRG
RSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFE
FALTAVAEEVNAILKALPQ
Download sequence
Identical sequences P56722
NP_001068599.1.59421 NP_001068599.1.76553 ENSBTAP00000018336 ENSBTAP00000018336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]