SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000018957 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000018957
Domain Number 1 Region: 90-210
Classification Level Classification E-value
Superfamily PX domain 8.07e-16
Family PX domain 0.0032
Further Details:      
 
Domain Number 2 Region: 292-347
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000137
Family SAM (sterile alpha motif) domain 0.0064
Further Details:      
 
Domain Number 3 Region: 893-923
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000384
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000018957   Gene: ENSBTAG00000014267   Transcript: ENSBTAT00000018957
Sequence length 947
Comment pep:known_by_projection chromosome:UMD3.1:18:13036326:13079896:-1 gene:ENSBTAG00000014267 transcript:ENSBTAT00000018957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLSGGGGGPGGKSALPTCPACHKVTPRTEPPVSSV
GNSLENALHTSTHSTEGSLPKRPGGKLSRVTVEKIDLKGLSHKKNERNVECSFEVLWSDS
SITSVTKSSSEVTEFISKLSQLYPEENLEKFIPCLAGPDSFYVERNHMDLEADLRYLASL
PSHVLKNDHVKKFFSTSSPTQQLQSPSPGNPSLSKVGTMMGVSGRPVCGVAGIPSSQGSA
QHHVQHSASAAALPHCSHSGGAGSALAYRTPMDSSPAILMPSSLQAPQTQEQNGILDWLR
KLRLHKYYPVFKQLTMEKKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSEKRCLNP
SAPPPVSSSGVARVPPTSHVGPVQTVRGSHAAALRVEVEQAPHQTAREGSSSECSSSSPS
PMGVQAREESSDSAEENDRRVEIHLEGPDKEKPVMLLNHFTSSSARPTAQVLPVQNEAGS
TPSGHHSLPPQMMTAASHIAPIRMLNSVHKAERGSTDMKLLSSSVHSLLSLEERSKVSGP
RSSIKVDKSFGNTMMDVLPSSTPHQPMQVLSGLAESSSVSPTVSFGPRTKVVHASALDRV
MKPAQQPALVVEASTAAAGTSSTVFHVARPPIKLLVSSSVPADSAISGQTSCSNNVQISV
PPAIINPRTALYTANTKAAFSAMSSVPVGPLQGSFCANSNTAASSSHPSPSFANMATVPS
CPAPSSSPALSSVPESSFYSSSGGGGGGGSSPGNLPASAQNHHHHHHHQQQPVPQQPAPA
PPPGCVVCTSCGCSGSCGSSGLTVSYASYFQHPFSGPSVFPFPFLPFSPVCGSGYMGAQQ
YGGGAFPVVHSPYGGGVGPEPVLGGQSAFTVPPVQNFMGAAGVYQAQGLVGSSNGSSHKK
SGNLSCYNCGATGHRAQDCKQPSMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences E1BM00
ENSBTAP00000018957 9913.ENSBTAP00000018957 ENSBTAP00000018957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]