SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019083 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019083
Domain Number 1 Region: 589-655,792-1015
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.1e-64
Family Protein kinases, catalytic subunit 0.00041
Further Details:      
 
Domain Number 2 Region: 1061-1388
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.29e-40
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0042
Further Details:      
 
Domain Number 3 Region: 336-548
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-36
Family Protein kinases, catalytic subunit 0.00072
Further Details:      
 
Domain Number 4 Region: 17-144
Classification Level Classification E-value
Superfamily UBC-like 2.61e-35
Family RWD domain 0.000000987
Further Details:      
 
Domain Number 5 Region: 1394-1495
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0000305
Family Anticodon-binding domain of Class II aaRS 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019083   Gene: ENSBTAG00000014351   Transcript: ENSBTAT00000019083
Sequence length 1649
Comment pep:known_by_projection chromosome:UMD3.1:10:35707709:35804772:1 gene:ENSBTAG00000014351 transcript:ENSBTAT00000019083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDARGRVKEPPEINLVLY
PQGLTGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNESVNLLKSRLEEVAKKHCGE
VMIFELAYYVQSFLCEHNKPPPKSFHEEMLERRAQEEQRRQLEAKRKEEEEQREILHEIQ
KRKEEIKEEKKRKEMAKQERLEIAILSNQDHTSRKDPGGHRTAAILHGGSPDFVGNGKHR
TNSSGRSKRERQYSMCNSEDSPGSCEILYFSVGSPDQLMVHKGKCIGSDEQLGKLVYNAL
ETATGSFVLLHEWVLQWHKKMGPFLTSQEKEKIDKCKKQIQGAETEFSSLVKLSHPNIVR
YFAMNLKEQDDSIVVDILVEHTNGISLAAHLGHSGPIPVHQLRKYAAQLLSGLDYLHSNS
VVHKVLSALNVLVDAEGTIKITDYSISKRLADICKEDVFEQTRVRFSDSALPYKTGKKGD
IWRLGLLLLSLSQGQECEEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQSKIPLLEQSPEDSGGQDYVETVIPSNQLPSAAFFSETQRQFSRYFIEFEELQLLGKGA
FGAVIKVQNKLDGCCYAVKRIPINPASRHFRRIKGEVTLLSRLHHENIVRYYNAWIERHE
RPACPATPPPNSGPQAQDGQALAQPAGDSDPDGPGSVEAAAPPPILSSSVEWSTSGERSA
STRFPAAGPDSSSDEDDDEEQGVFSQSFLPASDSDSDIIFDNEDENSKSQNQDEDCNGKN
SCHESEPPATTEAVHYLYIQMEYCEKSTLRDTIDQGLYRDTVRLWRLFREILDGLAYIHE
KGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFAADGKQDDTSGDHLIKSDPSGHLTG
MVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTSP
KFPEDFDDGEHTKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHTLA
NVDGKAYRTMMGQIFAQRISPAIDYTYDSDILKGSFSIRTAKIQQHVCETIIRIFKRHGA
VQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRVPFARYVARNNILNLKRYCIE
RVFRPRKLDRFHPKELLECAFDIVTSTTNSSLPTAEIIYTIYEIIQEFPALQERNYSIYL
NHTMLLKAILLHCGIPEDKLSQVYVILYDAVTEKLTRREVEAKFCNLSLSSSSLCRLYKF
IEQKGELQDLTPTINSLIKQKTGVAQLVKYGLKDLEEVVGLLKKFGIKLQVLINLGLVYK
VQQHSGIIFQFVAFIRRRQRAISEILAAGGRYDLLIPQFRGPQALGPVPTAIGVSIAIDK
ITTAVLNMEEPVTVSSCDLLVVSVGQMSMSRAINLTQKLWSAGITAEIMYDWSQSQEELQ
EYCRHHEITYVALVSDKEGSHVKVKSFEKDRQTEKRVPESDLVDHVVQKLRTKVSDERTT
REASDNLTVQNLKGSFSNASGLFEIHGATVVPIVSVVAPEKLSASTRRRYETQVQTRLQT
SLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVC
DEIYNIKVEKKVSVLFLYSYRDDYYRILF
Download sequence
Identical sequences E1BAL6
XP_001787713.2.59421 XP_002690831.1.76553 ENSBTAP00000019083 ENSBTAP00000019083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]