SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019182 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019182
Domain Number 1 Region: 210-550,631-655
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.32e-92
Family Myotubularin-like phosphatases 0.0000103
Further Details:      
 
Domain Number 2 Region: 35-180
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-26
Family GRAM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019182   Gene: ENSBTAG00000014422   Transcript: ENSBTAT00000019182
Sequence length 764
Comment pep:known chromosome:UMD3.1:21:27947773:27984436:-1 gene:ENSBTAG00000014422 transcript:ENSBTAT00000019182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLKPPRPTFRSYLLPPPQTDDKINSEPKIKKLEPVLLPGEIVVNEVNFVRKCIASDTS
QYDLWGKLICSNFKISFITDDPMPLQKFHYRNLLLGEHDVPLTCIEQIVTLNDHKRKQKV
LGPNQKLKFNPTELIIYCKDFRIVRFRFDESGPESAKKVCLAIAHYSQPTDLQLLFAFEY
VGKKYHNSASKANGAPLGAGGGGSQKTPLFETYSDWDREVKRTGASGWRVCSINEGYMIS
TCLPEYFVVPSSLADQDLKVFSHSFVGRRMPFWCWSHSNGSALVRTALIRDVLQQRKIEQ
RICNAITKSHPQRNDVYKSDLDKTLPNIQDIQVAFVKLKQLCVNEPFEETEEKWLSSLEN
TRWLEYVRAFLKHAAELVYVLESKRLSVVLQEEEGRDLSCIIASLVQVMLDPYFRTITGF
QSLIQKEWVMAGYPFLDRCNHLKRSEKEAPVFLLFLDTTWQLLEQCPAAFEFSETYLAVL
HDSTRVALFGTFLFNSPHQRVQQSTEFAISKNIQLGDEKGLKFPSVWDWSLQFTPKDRTL
FHNPFYIGKSTPCVQNGSVKSFKRTKKSYSSTLRGMPASLKNGIISEEELRPRRNSLILQ
VKPAPLETRDSQDWGAERFFQERASRPADLHGTILPHLSGAHIKLWKLCYFRWVPEAQIQ
HGGFITAFHKLSLLADEVDVLSRALRQPRGGPMPAPGPELAPSRLYFCAGGPHDAPGTPD
FLSSSFPFSPVGNLCRRSISGTPLSKFLSGAKIWLSTETLANED
Download sequence
Identical sequences E1B9S5 L8ILD5
ENSBTAP00000019182 NP_001180002.1.59421 NP_001180002.1.76553 XP_005896408.1.15283 XP_019838939.1.53367 ENSBTAP00000019182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]