SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019193 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019193
Domain Number 1 Region: 5290-5448
Classification Level Classification E-value
Superfamily SET domain 9.29e-49
Family Histone lysine methyltransferases 0.0065
Further Details:      
 
Domain Number 2 Region: 1385-1445
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000509
Family PHD domain 0.0039
Further Details:      
 
Domain Number 3 Region: 272-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000117
Family PHD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1460-1528
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000111
Family PHD domain 0.025
Further Details:      
 
Domain Number 5 Region: 1339-1393
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000117
Family PHD domain 0.017
Further Details:      
 
Domain Number 6 Region: 224-277
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000132
Family PHD domain 0.01
Further Details:      
 
Domain Number 7 Region: 1990-2040
Classification Level Classification E-value
Superfamily HMG-box 0.00000279
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019193   Gene: ENSBTAG00000014429   Transcript: ENSBTAT00000019193
Sequence length 5448
Comment pep:known_by_projection chromosome:UMD3.1:5:30931917:30964080:1 gene:ENSBTAG00000014429 transcript:ENSBTAT00000019193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSPKPPGEDKDSEPAADGPAASEESGATEPDLPKPHVGEVSVPSSGGPRLQEPPQDCSG
GPVRRCALCNCGEPSLHGQRELRRFELPFDWPRCPVVSPGGNPGPSEGALPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCSRLYHFPCATASGSFLSMKTLQLLCPEHSEGATHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRCHKAPGGQPVSS
LAEQHPPVCSRFSPLEPGATPTDEPNSLYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLG
REGAQLEPQLEAPLNEEMPLLPPPEESPLSPPPEDSPTSPPPEASRLSPPPEDSPLSPPP
EESPLSPPPESPPFSSPEDSPPHPPLDTPLPPPPEASPLSPPLEESPLSPPPEELPTSPP
PEASRLSPPPEESPMSPPPEESPMSPPPEASCLFPPFEESPLSPPPEESPLSPPPEASRL
SPPPEDSPMSPPPEDLPMSPPPEVSRLSPPPEESPLSPPPEESPTSPPPEASRLSPPPED
SPTSPPPEDPPASPPPEDLLVSLPLEESPLLPLPEELRLCPRPEEPHLSPQPEKPRLSPA
PQEPRLSPASQEPRLSPAPQEPCLSPAPEEPRLSPAPQQPCLSPAPEEPRLSPAPQQPHL
SPVPPEEPCLSPRPEEPRLSPRPEEPRLSPRPEEPRLTPRPEEPHLSPRPEEPIEEPSLC
LASEELPLLLPPREPPLSPVLGEPALSEPGEPPLSPLPEELPLSPSGEPSLSPQLMPPDP
LPPPLSPIITTVAPPALSPLGELEYPFDAKGDSDPESPLAAPILETPISPPPEANCTDPE
PVPPMILPPSPGSPMGPASPILMEPLPPRCSPLLQHSLPPSNSPPSQCSPALPLLVPSPL
SPMDKAVEVSEEAEPQKMETEKAPEPECPALEPSPTSPLPSPLGNLSCPAPSPAPALDDF
CGLGEDTAPLDGTDTPGSQPEAGQTPGSLASELKGSPVLLDSEELAPVTPMEVYGPECKQ
AGQGSPCEEQEEPRAPVAPTPPILIKSDIVNEISNLSQGDASASFPGSEPLLGSPDPEGG
GSLSMELGVSTDVSPARDEGSLRLCTDSLPETDDSLLCDAGTAIGGGKAEGDKGRRRSSP
ARSRIKQGRSSSFPGRRRPRGGAHGGRGRGRARLKSTTSSIETLVVADIDSSPSKEEEDD
DDDTMQNTVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITK
VMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCV
SCMQCGAASPGFHCEWQNSYTHCGPCASLVTCPICHAPYVEEDLLIQCRHCERWMHAGCE
SLFTEDDVEQAADEGFDCVSCQPYVVKPAAPVAPPELVPMKVKEPEPQYFRFEGVWLTET
GMAVLRNLTMSPLHKRRQRRGRPGLPGEAGLEGAEPSEVLGPDDKKDGDLDTDELLKAEG
SVEHMECEIKLEGPVSPDGEPGKEETEESKKRKRKPYRPGIGGFMVRQRKSHTRVKKGPA
AQAEVLSGDGQPDEVLPADLPAEGSVDQGLADGDEKKKQQRRGRKKNKLEDMFPAYLQEA
FFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDVADEESR
GPEGKADTPAIAGPEDGGIKASPVPSDPEKPGTPGEGMLSSDLDRIPTEELPKMESKDLQ
QLFKDVLGSEREQHLGCGTPGLDGSRTPLQRPFLQGGLPLGNLPSNSPMDSYPGLCQSPF
LDSRERGGFFSPEPGEPDSPWTGSGGTTPSTPTTPTTEGEGDGLSYNQRSLQRWEKDEEL
GQLSTISPVLYANINFPSLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHR
INKVQKQAESQINKQTKVGDMARKTDRPALHLRIPPQPGALGSPPPAAAPTIFIGSPTPP
AGLSTSADGFLKPPAGTVPGPDSPGELFLKLPPQVPAQVPSQDPFGLASAYALEPRFPTA
PPTYPPYPSPTGAPAPPPTLGASSRPGTGQPGEFHTTPPGTPRHQPSTPDPFLKPRCPSL
DNLAVPESPGGGGSKAAEPLLSPLPFGESRKALEVKKEELGGSSPSYGPPNLGFVDSPSS
GPHLGGLELKAPDVFKAPLTPRASQVEPQSPGLGLRPQEPPPAQALAPSPPSHSDIFRPG
PYPDPYAQPPLTPRPQPPPPESCCALPPRSLPSDPFSRVPASPQSQSSSQSPLTPRPLSA
EAFCPSPVTPRFQSPDPYSRPPSRPQSRDPFAPLHKPPRPQPSEVAFKAGPLAHTPLGAG
GFPAALPSGPAGELHAKVPSVQPPNFARSPGTSAFVGAPSPMRFTFPQAVGEPPLKPPVP
QPGLPPPHGINSHFGPGPTMGKPQSTNYAVAAGNFRPSGSPLGPSSGPAGEGYGPSPLRP
PSVLPQPTPDGPLPCLPHGATQRAGITSPVEKREDPGAGTGSSLAAPELSGTQDPGMSGL
SQTELEKQRQRQRLRELLIRQQMQRNTLRQEKETAAAAGAVGPPGNWGAEPSSPAFEQLG
RGQTPFAGTQDKSSLVGLPPSKLGGPILGPGAFPSDDRLSRPPPPATPSSMDVNSRQLVG
GSQAFYQRAPYPGSLPLQQQQQQQLWQQQQQATAAASMRLTMSARFPSTPGPELGRQTLG
SPLAGISNRLPGPGEPVPGPAGPAQFIELRHNVQKGLGPGGPPFPGQGPPQRPRFYPVTE
DSHRLAPEGLRGLAVSGLPPQKPSAPPAPELNNSLHPTPHTKGPNLPTGLELVSRPPSST
ELGRPPPLTLEAGKLPCEDPELDDDFDAHKALEDDEELAHLGLGVDVAKGDDELGTLENL
ETNDPHLDDLLNGDEFDLLAYTDPELDTGDKKDIFNEHLRLVESANEKAEREALLRGVEP
GPFGPEERPPPAADASEPRLASGLPEVKPKVEEGGRHPSPCQFTITTPKAELAPVTTSLG
LGVKPGQSVTGSRDTRMGTGPFSSSGHTAEKVPFGTTGGPPAHLLTPSPLSGPGGSSLLE
KFELESGALTLPGGHASGDELDKMESSLVASELPLLIEDLLEHEKKELQKKQQLSAQLQP
VQQQQPQQHSLLSTPGPGQAVSLPHEGSSPSLAGPQQQLALGLGGSRQPGLAQPLMPNQP
PAHALQQRLAPSMAMVSNQGHMLSGQHGGQAGLVPQQNPQPVLAQKPMGTVPPSMCMKPQ
QLAMQQQLANSFFPDTDLDKFAAEDIIDPIAKAKMVALKGIKKVMAQGSIGVAPGMNRQQ
VSLLAQRLSGGPGSDLQNHVAAGSGQERGAGDSSQPRPNPPTFAQGVINEADQRQYEEWL
FHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQSKI
QKQLDQVRKQQKEHTNLMAEYRNKQQQQQQQQQQQQQQHSAVLALSPSQSPRLLTKLPGQ
LLPGHGLQPPQGPPGGQAAGLRLTPGGMALPGQPGGPFLNTTLAQQQQQQHSGGAGALAG
PSGGFFPGNLALRGLGPDSRLLQERQLQLQQQRMQLAQKLQQQQQQHLLGQVAIQQQQQQ
GPGVQANQALGPKPQGLLPPSSHQGLLVQQLSPQPPPGPQGMLGPAQVAVLQQQQPHPGA
LGPQGPHRQVLLTQPRVLSSPQMAQQGQGLMGHRLVTSQQQQQQQHQQQGSMAGLSHLQQ
GLMPHSGQPKVGAQPMAALQQQQLQQQQQQQQQQQQQLQQQQQIGLLSQSRALLSPQQQQ
QQQQMTLGPGMPAKPLQHFSSPGALGPTLILTGKEQSIVETALPSEASEGSSTHQGGPLP
MGTVPESVAPEPGEVKPSLSGDSQLLLVQPQAQPQPNSLQLQPPLRLPGQQQPPVNLLHT
AGAGSHGQPGSGSSEASSVPHLLAQSSVSLGEQPGSVTQNLLSSQQPLGLERPMQNNIGP
QPAKPGSVPQSGQSLPGAGVMPTVGQLRAQLQGVLAKNPQLRHLSPQQQQQLHALLMQRQ
LQQSQAARQAPPYQEPGTQPSPLQGLLGRQPQLGGFPGSQTGPLQELGAGLRPQGPPRLP
APQGALSTGPVLGPVHPTPPPSSPQEPKRPSSQLPSPSSQLPSEAQLPTTQPGTPKPQGP
PLELPPGRVSPAAAQLADTFFGKGLGPWDPPDHLAEAQKLEQSSLVPGHLDQVNGQVVPE
PPHLNIKQEPREEPCALGSQAVKREANGEPVGAPGTSNHLLLAGPRSEAGHLLLQKLLRA
KNVQLSTGRGPEGLRAEINGHIDSKLAGLEQKPQGTPSTKEDTAARKPLTPKPKRVQKAS
DRLVSSRKKLRKEDGVRASEALLKQLKQELSLLPLTEPTITANFSLFAPFGSGCPISGQC
QLRGAFGSGVLPTGPDYYSQLLTKNNLSNPPTPPSSLPPTPPPSVQQKMVNGVTPSEELG
EHPKDAACARDTEGVLRDASEVKSLDLLAALPTPPHNQTEDVRMESDEDSDSPDSIVPAS
SPESILGEEAPRFPQLGSGRWEQDDRALSPVIPIIPRASIPVFPESKPYGVLDLETTRKL
PAPTWEKGKGSEVSVMLTVSAAAAKNLNGMMVAVAELLSMKIPNSYEVLFPESPARAGIE
PKKGEAEGPGGKEKSLGGKSPEAGPDWLKQFDAVLPGYTLKSQLDILSLLKQESPAPEPP
AQHSYTYNVSNLDVRQLSAPPPEEPSPPPSPLAPSPASPPAEPLVELPAEPSAEPPIPSP
LPLASSPESTRPKPRARPPEEGEDSRPPRLKKWKGVRWKRLRLLLTIQKGGVRQEDEREV
AEFMEQLGTALRPDKVPRDMRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEV
YETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDK
TMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIG
QLLPHQMADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSIGENNGRPEFVIKVMEQG
LEDMVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLP
GVESCQNYLFRYGRHPLMELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKAYQSTFT
GETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGT
IIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFD
KEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWMN
Download sequence
Identical sequences E1B9N8
ENSBTAP00000019193 ENSBTAP00000019193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]