SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019587 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019587
Domain Number 1 Region: 263-410
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.28e-18
Family Single-domain sulfurtransferase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019587   Gene: ENSBTAG00000014722   Transcript: ENSBTAT00000019587
Sequence length 496
Comment pep:known_by_projection chromosome:UMD3.1:8:63271189:63297828:-1 gene:ENSBTAG00000014722 transcript:ENSBTAT00000019587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSTSPDQGDDDLEACVLRFSDLDLKDTSLMNPSSSLKAELDVSAKKKYSFAKKKAFSL
FVKTKEVPAPPCECKEKWWKCCQQLFTDPTSIHRHVATQHANEICHETASVLKQLAVTSS
TSKSLESTDKRNPFKEDFTRNQEVSTWLPDISCFNPDELISGQGNDEGEVLLYYCYCDLK
DPDWVCAWQTALCQHLHLTGKVRIATEGINGTVGGSRLATRLYVSVMLSCPLFKDYLCKD
DFKTSKGGACCFPELRVGVFEEIVPMGISPNKISYKKPGIHLSPGEFHKEVEKFLSQANQ
EESDTILLDCRNFYESKIGRFQGCLAPDIRKFSYFPSYVDENLELFKEKRVLMYCTGGIR
CERGSAYLKTKGVCKEVFQLKGGIHKYLEEFPDGFYKGKLFVFDERYALSFNNDIVSECS
YCGVPWDHYNLCSTPQCRQLVLTCPACQERGFTACCVTCQDKGNRQAASPAQSSFKEECE
CTARRPRVPRELSRRG
Download sequence
Identical sequences E1BP51
9913.ENSBTAP00000019587 ENSBTAP00000019587 ENSBTAP00000019587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]