SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020096 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020096
Domain Number 1 Region: 79-164
Classification Level Classification E-value
Superfamily HMG-box 2.36e-31
Family HMG-box 0.00000617
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily HMG-box 3.53e-27
Family HMG-box 0.00000728
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000020096
Domain Number - Region: 183-208
Classification Level Classification E-value
Superfamily ARM repeat 0.0863
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020096   Gene: ENSBTAG00000015101   Transcript: ENSBTAT00000020096
Sequence length 209
Comment pep:known chromosome:UMD3.1:8:5583684:5586018:-1 gene:ENSBTAG00000015101 transcript:ENSBTAT00000020096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKF
EDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGL
SIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTG
SKKKNEPEDEEEEEEEEDEDEEEEDEDEE
Download sequence
Identical sequences A0A0D9S252 A0A2K5K6C0 A0A2K6CMK2 A0A2K6NV24 H2QQF6 H9EQP8 L8IR12 P26583 P40673
ENSP00000296503 ENSP00000393448 ENSP00000404912 ENSBTAP00000020096 ENSP00000296503 ENSTTRP00000014824 ENSBTAP00000020096 ENSP00000296503 ENSP00000393448 ENSP00000404912 ENSPTRP00000028484 ENSPTRP00000028484 9598.ENSPTRP00000028484 9606.ENSP00000296503 9913.ENSBTAP00000020096 ENSTTRP00000014824 gi|11321591|ref|NP_002120.1| gi|194688133|ref|NP_001124160.1| gi|194688135|ref|NP_001124161.1| NP_001032705.1.59421 NP_001032705.1.76553 NP_001124160.1.87134 NP_001124160.1.92137 NP_001124161.1.87134 NP_001124161.1.92137 NP_002120.1.87134 NP_002120.1.92137 XP_003823467.1.60992 XP_003823468.1.60992 XP_003950520.1.37143 XP_004278726.1.21590 XP_004657191.1.11716 XP_004657192.1.11716 XP_005892822.1.15283 XP_006063814.1.26621 XP_007998463.1.81039 XP_007998465.1.81039 XP_010362296.1.97406 XP_010362297.1.97406 XP_010838549.1.44457 XP_011714047.1.29376 XP_011714048.1.29376 XP_011815002.1.43180 XP_011815003.1.43180 XP_012391776.1.21590 XP_012391777.1.21590 XP_014332787.1.15283 XP_016808005.1.37143 XP_019787921.1.83887 XP_019787922.1.83887 XP_019787924.1.83887 XP_019821332.1.53367 XP_517538.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]