SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021174 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021174
Domain Number 1 Region: 14-172
Classification Level Classification E-value
Superfamily EF-hand 1.69e-24
Family Calmodulin-like 0.01
Further Details:      
 
Domain Number 2 Region: 176-238
Classification Level Classification E-value
Superfamily EF-hand 0.00000000106
Family Calmodulin-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021174   Gene: ENSBTAG00000015924   Transcript: ENSBTAT00000021174
Sequence length 261
Comment pep:known chromosome:UMD3.1:14:75988982:76010903:1 gene:ENSBTAG00000015924 transcript:ENSBTAT00000021174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKT
FVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIET
EELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLK
FQGVKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNIPTYKKSIMA
LSDGGKLYRTDLALILSAGDN
Download sequence
Identical sequences D2HLS9 M3YHY4 P04467 U6CQ50
ENSBTAP00000021174 ENSBTAP00000021174 ENSMPUP00000010941 NP_001069663.1.59421 NP_001069663.1.76553 XP_002923342.1.58354 XP_004011895.1.66739 XP_004767039.1.14098 XP_005689308.1.57651 XP_010860375.1.44457 XP_011994109.1.54773 XP_019829043.1.53367 XP_020725685.1.74333 ENSMPUP00000010941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]