SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021566 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021566
Domain Number 1 Region: 228-483
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.18e-66
Family Eukaryotic proteases 0.000000269
Further Details:      
 
Domain Number 2 Region: 49-163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-23
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021566   Gene: ENSBTAG00000016204   Transcript: ENSBTAT00000021566
Sequence length 487
Comment pep:known_by_projection chromosome:UMD3.1:5:103633960:103644323:1 gene:ENSBTAG00000016204 transcript:ENSBTAT00000021566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPPQLWSLQLWGKPHSTRCPGNMWWFLLWGVLQAFPTQGSVVLLAQWLPQKLTSPGYPE
PYVKGQESSTDIEAPEGYVVRLLFQDFDLEPSPDCERDSVTLTASGMDLGQFCGQQGSLL
GRPPGQKEFVSSGNSLRLTFSAPASEDKTPGFHKGFLALYQAVAVNYTQPINQATGGPKA
IPTPGDNPTEIQSCCQEPYYEAKPSGTLTCTAQVPWKQTQKREEAPRCVPVCGRPVVPIS
QTRESLGASRAELGSFPWQALTSIYGRGGGALLGDRWVLTAAHTIYPKDSILLGRNRSAQ
VFLGHTDTDQMLELGRHPVRRVVVHPDYHQEEPHDFHGDIALLELERSVPLGPHLLPVCL
PDREALYRPGRWGYVSGFGVEMDWLSTKLKYSRLPVAPRAACEAWLRERQRPEAFTDGMF
CAGDQTRPQSVCQGDSGGAFVVWDDRTQRWVATGIVSWGIGCGEGYGFYTKVLDYVDWIR
GVMGEKD
Download sequence
Identical sequences F1N1S6
ENSBTAP00000021566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]