SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022037 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022037
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily Globin-like 1.04e-47
Family Globins 0.000000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022037   Gene: ENSBTAG00000038921   Transcript: ENSBTAT00000022037
Sequence length 142
Comment pep:known chromosome:UMD3.1:25:206853:208001:1 gene:ENSBTAG00000038921 transcript:ENSBTAT00000022037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISLTRTERTIIVSLWSKISTQADVIGTKTLERLFSCYPQAKTYFPHFDLHTGSAQLRAHG
SRVVAAVGDAVKSIDNVTSALSKLSELHAYVLRVDPVNFKFLSHCLLVTLASHFPADFTA
DAHAAWDKFLSIVSGVLTEKYR
Download sequence
Identical sequences F1MMI1
ENSBTAP00000022037 ENSBTAP00000022037 9913.ENSBTAP00000022037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]