SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022553 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022553
Domain Number 1 Region: 1821-1927
Classification Level Classification E-value
Superfamily SET domain 2.88e-26
Family Histone lysine methyltransferases 0.0032
Further Details:      
 
Domain Number 2 Region: 85-184
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.26e-17
Family Canonical RBD 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022553   Gene: ENSBTAG00000004172   Transcript: ENSBTAT00000022553
Sequence length 1965
Comment pep:known_by_projection chromosome:UMD3.1:17:55727012:55747669:-1 gene:ENSBTAG00000004172 transcript:ENSBTAT00000022553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSHPPHHHHQQPPPQPGPSGERRNHHGDSFLARGVVPALAAGRRGQSWGGWVFTLHCF
QRAGEWEMFCFPFGFNVLQTPFPLVPCQIDEFYVGPVPPKQVTFAKLNDNIRENFLRDMC
KKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDTKGE
TRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDGGLSAGCGSSSSSV
TPNSGGTPFSQDTAYSSCRLDTPNSYGQGTPLTPRLGTPFSQDSSYSSRQPTPSYLFSQD
PTTTFKARRHESKFTDAYNRRHEHHYVHNSSAVTAVAGATAAFRGAVDLPFGAVGGSGGS
SGPPFKAQPQDSATFAHTPPPTQATPAPGVAFKSAFSPYQTPVPPFPPPPEEPTTTAPFG
ARDSGEFRRAPAPPPLPPAEPLTKEKPGTPPGPPPPEANSIELGGRPTFGWSPEPCDSPG
TPTLESSPAGPEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTELQMEGSPISSSSSQLS
PLAPFGANSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDGELDLGLGPRPPPEPGPP
DPTGLLGQTSETALDLAGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSADCPKPMV
VTPGAGAVAAPSVLAPTLPLPPPPGFPPLPPPPPPPPPQPGFPMPPPLPPPPPPPPPAHP
AVTVPPPPLPAPPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGSMPMSFQMQTQ
MLSRLMTGQGTCPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLGNTGPGRGQPWPPLPKF
DPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWWDKK
ERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLSYEGLGLGIGLRGAIRLP
SFKVKRKEPPDTASSGDQKRLRPSTSVDEEDEESERERDRDMADAPCELAKRDPKGMGVR
RRPARPLELDSGGEEDEKESLSVSSSSSASSSSGSSTTSPSSSASDKEERESTEEEEEGE
GEEEGEEGPRSQISSSSTSSMSDKDDDDEDSDDRDESENDDEDTALSEASEKEEGDSDGE
ETVSITTSKPGAESSSESSESSDFASSSESSSSSSSEDEEELPAGEDEEEEEEEGEAAAD
ESMAPTAPDEDFENEVVTGAPTTESQGPEEEVDIEAEDEAPKERTPMLEEPPLPVSVEEL
TGCKEPPGEPGLNQEGARLLSPEPPAGEMEARPLPSPEPTPEDNLEAEPEAPALLSLPLQ
PPLPPPRPPRPPSPPPEPKTPDPPLPSVPLEPPPHEEQPPRTPSLCGSLGKSQSAEAVPA
TPSGEPLPTAGSGGLALSSPQLPGSPFSYPSPSPSLSSGGLPRTPGRDFSFTPTFPEPGG
PLLLPVCPLPAGRRDDRSGPLASPVLLETGLPLPLPLPLPLPLALPVPVLRAQSRAPTQL
PPLLPAPLAPCPPPIKRKPSGPRRSPPAVLTLDGPLVRPPGGAALGRDLLLLPGQPQTPV
FPSTHDPRTVTLDFRNAGIPAPPPPLPPQPPPPPPPPPVEPTKLPFKELENQWPSEAIPP
GPRGRDEISDEFMAKVRGSWRRPPKKRHEDLVVSASPELSPPQPLFRPRSEFEEMTILYD
IWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPPPTSLSSAKKKKRDDGIREH
MTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPTDTQGMSIPAQPHASTRAGSERRSEQR
RLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIR
QVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNVGCLHSMVTCHSL
GPEIIRFYCNHHAHLTSEARGDYKFPIEDVKIPALGSENCRGPST
Download sequence
Identical sequences F1N6Y5
ENSBTAP00000022553 ENSBTAP00000022553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]