SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023205 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023205
Domain Number 1 Region: 17-162
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-37
Family Dual specificity phosphatase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023205   Gene: ENSBTAG00000017459   Transcript: ENSBTAT00000023205
Sequence length 188
Comment pep:known chromosome:UMD3.1:17:71750227:71755793:-1 gene:ENSBTAG00000017459 transcript:ENSBTAT00000023205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASPCAFPVQFRQPSVSGLSQITSSLYISSGVAANNRLMLSSNRISTVINVSVEVVNAL
YEDIHYVQVPVADTPTSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLM
KYHAMSLLDAHTWTKSCRPIIRPNNGFWEQLIHYEFQLFGRNTVHMVSSPVGMIPDIYEK
EVRQMIPL
Download sequence
Identical sequences Q5BIP9
NP_001029431.1.59421 NP_001029431.1.76553 XP_005906463.1.15283 XP_019833411.1.53367 ENSBTAP00000023205 ENSBTAP00000023205 9913.ENSBTAP00000023205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]