SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025510 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025510
Domain Number 1 Region: 412-736
Classification Level Classification E-value
Superfamily DNase I-like 1.57e-58
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0001
Further Details:      
 
Domain Number 2 Region: 25-124
Classification Level Classification E-value
Superfamily SH2 domain 6.46e-27
Family SH2 domain 0.00015
Further Details:      
 
Domain Number 3 Region: 1204-1262
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000561
Family SAM (sterile alpha motif) domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025510   Gene: ENSBTAG00000019167   Transcript: ENSBTAT00000025510
Sequence length 1264
Comment pep:known chromosome:UMD3.1:15:52609012:52623088:1 gene:ENSBTAG00000019167 transcript:ENSBTAT00000025510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASACGAPGPGGAGPGAALGSPAPAWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGA
FALCVLYQKHVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELISLYAQPNQGLVCALLL
PVEREREPDPPDDRDASDGEDEKPPLPPRSGSTSISAPMGPSSPPAAPETPTTPAAESAP
NGLSTVSHEYLKGSYGLDLEAVRGGASNLPHLTRTLATSCRRLHSEVDKVLSGLEILSKV
FDQQSSPMVTRLLQQQNPPQTGEQELESLVLKLSVLKDFLSGIQKKALKALQDMSSTAPP
APLQPSTRKAKTIPVQAFEVKLDVTLGDLTKIGKSQKFTLSVDVEGGRLVLLRRQRDSQE
DWTTFTHDRIRQLIKSQRVQNKLGVVFEKEKDRTQRKDFIFVSARKREAFCQLLQLMKNK
HSKQDEPDMISIFIGTWNMGSVPPPKNVTSWFTSKGLGKTLDEVTVTIPHDIYVFGTQEN
SVGDREWLDLLRGGLKELTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGI
ANTLGNKGAVGVSFMFNGTSFGFVNCHLTSGNEKTARRNQNYLDILRLLTLGDRQLSAFD
ISLRFTHLFWFGDLNYRLDMDIQEILNYISRKEFEPLLRVDQLNLEREKHKVFLRFSEEE
ISFPPTYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSYGCTDDIV
TSDHSPVFGTFEVGVTSQFISKKGLSKTSDQAYIEFESIEAIVKTASRTKFFIEFYSTCL
EEYKKSFENDAQSSDNINFLKVQWSSRQLPTLNPILADIEYLQDQHLLLTVKSMDGYESY
GECVVALKSMIGSTAQQFLTFLSHRGEETGNIRGSMKVRVPTERLGTRERLYEWISIDKD
EAGAKSKAPSVSRGSQDPRSGSRKPASTEASCPLSKLFEEPEKPPPTGRPPAPPRAAPRE
EPLTPRLKPEGAPELEGVVAPPPKNSFNNPAYYVLEGVPHQLLPPEPPSPARAPVPPATK
NKVAITVPAPQLGRHRPPRAGEGSSSDEDSGGTLPPPDFPPPPLPDSAIFLPPGLDPLPG
PVIRGRSGGEARGPPPPKAHPRPPLPPGPSPASTFLGDVASGDDRSCSVLQMAKTLSEVD
YAPAGPGRAMLLPGPLELQPPRGLPSDYGRPLSFPPPRIRESIQEDLAEEAPCPQVGRAG
GLGEAGMGAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTL
QLSK
Download sequence
Identical sequences E1BBJ7
ENSBTAP00000025510 ENSBTAP00000025510 NP_001178105.1.59421 NP_001178105.1.76553 9913.ENSBTAP00000025510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]