SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025957 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025957
Domain Number 1 Region: 90-269
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-49
Family Ypt/Rab-GAP domain of gyp1p 0.0037
Further Details:      
 
Domain Number 2 Region: 244-356
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-28
Family Ypt/Rab-GAP domain of gyp1p 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025957   Gene: ENSBTAG00000019488   Transcript: ENSBTAT00000025957
Sequence length 831
Comment pep:known_by_projection chromosome:UMD3.1:13:12778211:12833138:1 gene:ENSBTAG00000019488 transcript:ENSBTAT00000025957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTEAVVNSQGQTGYLTKDSNQDVALKLAQERAEIVAKYDRGREGAEIEPWEDADYLVYK
VTDRFGFLHEEELPYHNAAMERQKHLEIERTTKWLKMLKGWEKYKNTEKFHRRIYKGIPL
QLRGEVWALLLEIPKMKEETRDLYSKLKHRARGCSPDIRQIDLDVNRTFRDHIMFRDRYG
VKQQSLFHVLAAYSIYNTEVGYCQGMSQITALLLMYMNEEDAFWALVKLFSGPKHAMHGF
FVHGFPKLLRFQEHHEKILNKFLSKLKQHLDSQEVYTSFYTMKWFFQCFLDRTPFTLNLR
IWDIYIFEGERVLTAMSYTILKLHRKHLMRLSMEELVEFLQETLAKDFFFEDDFVIEQLQ
ISMAELKRAKLDLPEPGKEDEFPKKPLGQLPPEGQSAGVTHLSNGQRSVGRSSPHPGGRR
GSGSPHKIHEPSPPHPRRTGTPERARQQRRKSSDEEGKRLRDEAQAQAQAQRRLPPGAQD
GSGQYNHAAANQNSNATSRARKEFAPRWHKPSEAAVLEKTAKSAVEGRSRAAPPALADPR
APHVRQKTKVLDADEGKRGSTASQYDNVPEDGPGGAVEEALERARAQSPRRPAEPGASPS
RAPPKFAFKVLPSSYAQHPFLPDGEDRGPAHPPSYSNPPTYQGSSPKRVPAANSSFPFPP
GAHTNPSRRPYGSTLSISASPEKSYSRPTPLVQPSSRIEVLPVDLGAGGYSGNSGSPKNG
RFILPPGDCLPDNRKWSEVGYTWRPEMHGQPWTRDVNRGHLSSFPRHPTFHHAPYQDHSL
PSVSVDGPVRYRTSPALEDATSPGFQYSGPSPPAYHYRNRDGLSMQESVLL
Download sequence
Identical sequences E1B7U3
ENSBTAP00000025957 NP_001179624.1.59421 NP_001179624.1.76553 ENSBTAP00000025957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]