SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026136 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026136
Domain Number 1 Region: 18-293
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.24e-92
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026136   Gene: ENSBTAG00000019617   Transcript: ENSBTAT00000026136
Sequence length 780
Comment pep:known_by_projection chromosome:UMD3.1:3:29666149:29722631:1 gene:ENSBTAG00000019617 transcript:ENSBTAT00000026136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQREILQKFLDEAQHRKSNKEEFANEFLTLKRLSSKYKADKTYPTTVAERPKNIKKNRY
KDILPYDHSLVELCMITSDEDSSYINANFIKGVYGPKTYIATQGPLPTTVLDFWRMIWEY
SILIIVMACMEFEMGKKKCERYWAEPGDTQLQLGPFSISCEAENRKSDYTIRTLKAKFNS
ETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQDDNSVPICIHCSAGCGRTGVLCAI
DYTWMLLKDGIIPENFSVFSLIQEMRTQRPSLVQTQQQYELVYNAVLELFTRQMDIIGDK
HSGTEIQAKDSVFEQNPNIEAKSYSPSLPKSNIKEATVMNQQSKGRIRVKSAEASSFDLR
TSEINEKEGLVMHSAKQSSSLEFLELNCGCNKNADTTMKWETKVFPIAGEPLQKHQSLDL
SSILFGAYPKSKPVNAAGRYSNLKKPILRTKSTPFELMQERDSKELDIKGNFYLESQPHN
SCVDQAQKVMHVSTAELNFSPLHDSKHQTCNAANAKQHDSGALNEHSYMSLVEDPYFSSL
SPSSAHSKTSFNLPQKQDGSVLPCSSLSKSSTTLFPYYNSHDSLTLSTLTNFPPPLNQET
AAVGELPQGVPTSSSSPVKVKIGTSLECSGTSESKKSDDLVRLRPSKSVKPRSPKSDLQQ
DRSSSPPPPLPERTLESFLLADEDCTQAQPVETCSTSCPNTMENSTSSKQTLKPPGKNFT
RSKSLKILRNVKKSICNSSPPNKPAETARSKNSSSFLNFGFANRFSKPKGPRNPPSTWKI
Download sequence
Identical sequences F1N6L3
ENSBTAP00000026136 ENSBTAP00000026136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]