SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028324 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028324
Domain Number 1 Region: 695-749
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 779-834
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000656
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number 3 Region: 365-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000371
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 532-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000868
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 453-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000103
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 740-781
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000803
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 7 Region: 824-875
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000026
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number 8 Region: 622-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000036
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028324   Gene: ENSBTAG00000021253   Transcript: ENSBTAT00000028324
Sequence length 1135
Comment pep:known_by_projection chromosome:UMD3.1:1:143569076:143617356:-1 gene:ENSBTAG00000021253 transcript:ENSBTAT00000028324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDGNEEIMFIWCEDCSQYHDSECPELGPVVMVKDSFVLSRARSSLPSNLEIRRLEDGA
EGVFAVTQLVKRTQFGPFESRRVAKWEKESAFPLKVFQKDGHPVCFDTSNEDDCNWMMLV
RPAAEPGHQNLTAFQHGSDVYFTTSRDIPPGTELRVWYAAFYAKRMDKPMLRQACPGLQA
AGTPENSTPVEAEPSQWVCKVCSATFLELQLLNEHLLGHLEQSKSGAPAGQQESAPEKEA
DVPRGEPAEVPKTVSATKEQKKKPRRGRKPKASKPEQPLVIVEGKEPAEQVTEIMTEVEP
VTVTPDERIMELVLGKLAATPSDTSSVPKFPHHQSGTITLKRSLILSSRHGIRRKVVRQL
GEHRRVYQCSICSKVFQNSSNLSRHVRSHGDKLFKCEECAKLFSRKESLKQHVSYKHSRN
EVDSEYRYRCGTCEKTFRIQSALEFHNCRTDDKTFQCEMCFRFFSTNSNLSKHKKKHGDK
KFACEVCNKMFYRKDVMLDHQRRHLEGVRRVKREDVEAGGGENLVRYRKEPSGCPVCGKV
FSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDDHQREEFIGKI
GISSEENDDHSDESADSEPHKYSCKRCQLTFGRGKEYLKHIMEVHKEKGYGCSICHRRFA
LKATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSHACEQCG
KSFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECRECHRKFA
QKVNMLKHYKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVTEYM
LQKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDA
SSIGIVQPELSLEQEELAEGKHVKATRRAPKRKQKPEEEAGATGPEDAAFSEFSEKEGSF
SGGVGDETDSAVQSIQQVVVTLGDPNVTTPSSSVGLTNITVTPITTTAGTQFTNLQPVAV
GHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDLQIHPQPEASNPQSVAHFINLTTL
VNSITPLGSQLGEQHPLTWRAVPQTDGPPPPPPAPAQQAAQPSVPAEQQPQMYSY
Download sequence
Identical sequences E1BEG7
ENSBTAP00000028324 XP_002685168.2.76553 XP_015317649.1.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]