SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028448 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028448
Domain Number 1 Region: 1092-1228,1285-1571
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.88e-111
Family Myotubularin-like phosphatases 0.0000033
Further Details:      
 
Domain Number 2 Region: 1770-1837
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000219
Family Pleckstrin-homology domain (PH domain) 0.0000221
Further Details:      
 
Domain Number 3 Region: 861-997
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000602
Family GRAM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028448   Gene: ENSBTAG00000021337   Transcript: ENSBTAT00000028448
Sequence length 1840
Comment pep:known_by_projection chromosome:UMD3.1:5:119959433:119985418:-1 gene:ENSBTAG00000021337 transcript:ENSBTAT00000028448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGEGQGQILQRFPEKDWEDNPFPQGIELFCQPSGWQLSKRNPPTFFVAVLTDINSERHY
CACLCFWEPVEPTQEELCARDAAERDEEANEGGPGALPPPTPSPPGQLFAPKTLVLVSRL
DHVEVFRNSLGLIYTIHVEGLNVGLENVVGNLLTCVIPLAGGSQRTISLGAGDRQVIQTP
LTDSLPISRCSVALLFRQLGITNVLSLFCAALTEHKVLFLSRSYQRLSDACRGLLALLFP
LRYSFTYVPILPAQLLEVLSTPTPFIIGVNAAFQAEAQELLDVIVADLDGGTVTVPECVH
IPPLPEPLQSQTHSILSMVLDPELELADLAFPPPTTSISSLKMQDKELRAVFLRLFAQLL
QGYRWCLHMVRIHPEPVIRFHKAAFLGQRGLVEDDFLMKVLEGMAFAGFVSERGVPYRPT
DLFDELVAHEVARMRADENHPQRVLRHVKELAEQLYKNENPYPAVAMHKVQRPGEASHLR
RAPRPFPRLDEGMVQWIVDQATAKMQGAPPAVKAEKRTTVPSGPPMTAIVERSGGLHGNS
ARRLEVVRNCISYVFEGKMLEAKKLLPAVLRALKGRAARRCLAQELHLHVQQNRAVLDHQ
QFDFVVRMMNCCLQDEHGIAAALLPLVTAFCRKLSPGVTQFAYSCVQEHVVWSTPQFWEA
MFYGDVQTHIRALYLEPAEDRDSFSVGEAPVQEDERSALDVASEQRRLWPTLSREKQQEL
VQKEESTVFSQAIHYANRMSYLLLPLDSSKSRLLRERAGLGELESASNSLVTNSMAGSVA
ESYDTESGFEDAETCDVAGAVVRFINRFVDKVCTESGVTSDHLKGLHVMVPDIVQMHIET
LEAVHRESKRLPPIQKPKLLRPRLLPGEECVLDGLRVYLLPDGREEGAGGPGGGPALLPA
EGAVFLTTYRVIFTGMPTDPLVGEQVVVRSFPVAALTKEKRVSVQTPVDQLLQDGLQLRS
CTFQLLKMAFDEEVGSDSAELFRKQLHKLRYPPDIRGTFALSLGSAHTPGRPPRANKDKG
PSFRTLSRNLVKNAKKTIGRQYVTRKKYNPPSWEHRGQPPPEDQEDEISVSEELEPSTLT
PSSALKPSDRMTMSSLVERACCRDYQRLGLGTLSSSLSRAKSEPFRISPVNRMYAICRSY
PGLLIVPQSVQDNALQRVSRCYRQNRFPVVCWRSGRSKAVLLRSGGLHGKGVVGLFKAQN
APSPGQSQADSSSLEQEKYLQAVVSSMPRYADASGRNTLSGFSSAHMGSHGKWGSVRASG
RSGGLSTDVGSRLAGVGPPQANGAPPEPGFLRPQRAALYIIGDKAQLKGVRPDPLQQWEL
VPIEVFEARQVKASFKKLLKACVPGCPATEPSPASFLRSLEDSEWLIQIHKLLQVSVLVV
ELLDSGSSVLVSLEDGWDITTQVVSLVQLLSDPFYRTLEGFRLLVEKEWLSFGHRFSHRG
AHTLAGQSSGFTPVFLQFLDCVHQIHLQFPMEFEFSPFYLKFLGYHHVSRRFRTFLLDSD
YERIELGLLYEEKGDRRAPQACRSVWEYVERLSKRTPVFYNYMYAPEDAEVLRPYSNVSN
LKVWDFYTEETLAEGPPYDWELAQGPPEPPEEERPDGGAPQSRRRVVWPCYDSRPRAQPD
AISRLLEEMQRLETELGRPPERWKDAWDRVKAAQRLEGRPDGRGTPSSLLVSSVPHHRRS
LGVYLQEGPVGSTLSLSLDSDQSSGSTASSSRQAARRSTSTLYSQFQTAESENRGAFGGL
QGFFRTDWWGRPCRWSPRDLTSAGKKWSCHRADTECKGVIDLAEVEAVAPGTPAMGAPKT
VDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDQIQSCLSDA
Download sequence
Identical sequences G5E5Q8
ENSBTAP00000028448 ENSBTAP00000028448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]