SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028830 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028830
Domain Number 1 Region: 92-225
Classification Level Classification E-value
Superfamily Nudix 4.87e-23
Family MutT-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028830   Gene: ENSBTAG00000021635   Transcript: ENSBTAT00000028830
Sequence length 302
Comment pep:known chromosome:UMD3.1:3:21619324:21624613:-1 gene:ENSBTAG00000021635 transcript:ENSBTAT00000028830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARVLLLLSGRPESVSFAQSVCGLLGAGSGLGPWPTHCGLKRGQLVLSDKPFPGASAR
LPLQRPPFCPFAALDQQPRAPGVELPPKGRGVDLGVAVILQSSDQTVLLTRRTSTLNISP
NLWVPPGGHVEPDEELLDGGLRELWEESGLQLPQGQFSWVPLGLWESAYPPKLSWGLPKY
HHIVLYLLVISQESQQQLQARIQPNAGEVSAFMWLGPDIAAAVAATEDGTETPKHLPQDL
PSSVPTVELKENGGAQPLALPTSTLLRTTPGTADSRERVSTGTKFALTLWLQHLGRKSRD
GS
Download sequence
Identical sequences A4FUG7
NP_001076852.1.59421 NP_001076852.1.76553 9913.ENSBTAP00000028830 ENSBTAP00000028830 ENSBTAP00000028830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]