SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030018 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030018
Domain Number 1 Region: 33-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-72
Family Calponin-homology domain, CH-domain 0.0000192
Further Details:      
 
Domain Number 2 Region: 281-403
Classification Level Classification E-value
Superfamily Spectrin repeat 8.87e-33
Family Spectrin repeat 0.000000735
Further Details:      
 
Domain Number 3 Region: 517-638
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-31
Family Spectrin repeat 0.0000043
Further Details:      
 
Domain Number 4 Region: 398-513
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-24
Family Spectrin repeat 0.00000194
Further Details:      
 
Domain Number 5 Region: 746-873
Classification Level Classification E-value
Superfamily EF-hand 5.04e-22
Family Calmodulin-like 0.093
Further Details:      
 
Domain Number 6 Region: 642-753
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-20
Family Spectrin repeat 0.00000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030018   Gene: ENSBTAG00000022244   Transcript: ENSBTAT00000030030
Sequence length 901
Comment pep:known_by_projection chromosome:UMD3.1:29:45230682:45242282:1 gene:ENSBTAG00000022244 transcript:ENSBTAT00000030030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMVLQPEGLGTGEGPFAGGRGGGEYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLR
KAGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVK
LVSIGAEGEEVAGGGRWGWGRGTTICTSQEQLIYQVETSAKEGLLLWCQRKTAPYRNVNV
QNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAED
IVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASEL
LEWIRRTVPWLENRVGEPSMSAMQRKLEDFRDYRRLHKPPRVQEKCQLEINFNTLQTKLR
LSHRPAFMPSEGKLVSDIANAWRGLEQAEKGYEDWLLSEIRRLQRLQHLAEKFQQKASLH
EAWTRGKEDMLSQRDYETASLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDY
HEAASVNSRCQAICDQWDNLGTLTQKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLD
GAVEDLQDVWLVHSVEETQSLVTAHDQFKATLPEADRERGAILGIQGEIQKICQTYGLRP
SSTNPYITLTPQDINTKWDTVRKLVPSRDQMLQEELTRQQVNERLRRQFAAQANAIGPWI
QGKVEEVGRLAAGMAGSLEEQMAGLRQQEQNIINYKSNIDRLEGDHQLLQESLVFDNKHT
VYSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKRNGMM
EPDDFRACLISMGYDLGEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTAEQVVA
SFKILAGDKNYITAEELRRELPAEQAEYCIRRMAPYKGAGAPAGALDYVAFSSALYGESD
L
Download sequence
Identical sequences G3X7I1
ENSBTAP00000030018 ENSBTAP00000030018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]