SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030401 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030401
Domain Number 1 Region: 303-494
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.37e-52
Family Ypt/Rab-GAP domain of gyp1p 0.0018
Further Details:      
 
Domain Number 2 Region: 476-594
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.33e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030401   Gene: ENSBTAG00000012828   Transcript: ENSBTAT00000030419
Sequence length 675
Comment pep:known_by_projection chromosome:UMD3.1:5:1454193:1506151:1 gene:ENSBTAG00000012828 transcript:ENSBTAT00000030419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CIPVGHCTGTMIIYEQEGVYIHSSLGKTNDQDSLISGILRVLEKDAEVIVDWRPLDDALD
SSSILYAGKDSSSVVEWTQAPKERAHRVAEHLNSYEAEWDMVNTVSFKKKPHTNGDAPSH
RNGKSKWSFLFSLTDLKSIKQNKEGMGWSYLVFCLKDDVVLPALHFHQGDSKLLIDSLEK
YVALCESPQDKRTLLVNCQNKSLSQSFENLLDEPAYGLIQKIKKDPYTATMVGFSKVTNY
IFDSLRGSDPSVHQRPPSEMADFLSDAIPGLKINQQEEPGFEVITKIDLGERPVVQRREP
VSLEEWTKNVDSEGRILNVDNMKQMIFRGGLSHALRKQAWKFLLGYFPWDSTKEERTQLQ
KQKTDEYFRMKLQWKSVSEEQEKRNSRLRDYRSLIEKDVNRTDRTNKFYEGQDNPGLILL
HDILMTYCMYDFDLGYVQGMSDLLSPLLYVMENEVDAFWCFASYMDQMHQNFEEQMQGMK
TQLIQLSTLLRLLDSGFCSYLESQDSGYLYFCFRWLLIRFKREFSFLDILRLWEVMWTEL
PCKNFHLLLCCAILESEKQQIMEKHYGFNEILKHINELSMKIDVEDVLCKAEAISLQMVK
CKELPQAVCEILGLQDSEVTTPDSDNGEDENTGMTICPASAFQSNLLPVLTASGGRDDNP
TEISMSPNVSRLTPA
Download sequence
Identical sequences F1N090
9913.ENSBTAP00000030401 ENSBTAP00000030401 ENSBTAP00000030401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]