SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031762 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031762
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 290-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-20
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 238-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.06e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 167-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000708
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 126-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000194
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 331-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000451
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031762   Gene: ENSBTAG00000014593   Transcript: ENSBTAT00000031816
Sequence length 439
Comment pep:novel chromosome:UMD3.1:18:58086970:58100603:-1 gene:ENSBTAG00000014593 transcript:ENSBTAT00000031816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKVQGSVSFEDVAVGFSQEEWQILGPSQKALYWDVMLENYCNLVSVGYQAPTPNSLFQL
EQGGPPWTVEGAALSPTCSGFVVENRRYTGKDSDGFSGYGKSSVCLQDNKTLSGIKYHGC
VKPSSTKSPLSGRQKTCSGRKPYARSECRKAFSRKAQLIRHQRTERGEKPHRCNACGKAF
MKFQLTEHQRTHTGEKPHEPNECGKAFSRRLQLMGLKSSHTGEKPYCGECGKAFSQRLLK
RHQRSHTREKLYGCSMWGKAFSQKAYLIAHQRLHTGEKPYECRECGRTFFLFKSDLTKHQ
RIHREEKPCECSDCKKAFRSKAKLIQHQRTHTRERPYGCSECGKALAHMLIKHKKTHWGE
KAVESPELEKPSFGRHSSSYLSELVQEQSPVNAVLAEIVSSGTQSLLKINISEIIWSRNV
ALVGNLFPRSDILVGFKEF
Download sequence
Identical sequences F1MS91
ENSBTAP00000031762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]