SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000034344 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000034344
Domain Number 1 Region: 306-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000389
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 255-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000193
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000034344   Gene: ENSBTAG00000010818   Transcript: ENSBTAT00000034452
Sequence length 511
Comment pep:known chromosome:UMD3.1:5:90899026:90960752:-1 gene:ENSBTAG00000010818 transcript:ENSBTAT00000034452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALTDMADLEELSRLSPLPPGSPGPAARGRAEPPEEEEEEDEEEEAEAEAVAALLLNG
GGGGGGVGGGEAETMSEPSPESASQAGEDDDEEEDDDEEEEDESSSGGGEEESSAESLVG
SSSGGSSSDETRSLSPGAASSSSGDGDGKEGLEEPKGPRGSQGGGGGGSSSSSVVSSGGD
EGYGTGGGGSSATSGGRRGSLEMSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMM
NGQGSTTSSSKNIAYNCCWDQCQACFTSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYN
TPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPK
AKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGH
SVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTAL
LLDPNIYRTMPQKRLKRTLIRKVFNLYLSKQ
Download sequence
Identical sequences A4FV57
NP_001076954.2.59421 NP_001076954.2.76553 ENSBTAP00000034344 ENSBTAP00000034344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]