SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039132 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039132
Domain Number 1 Region: 95-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000471
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 495-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000754
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 3 Region: 727-782
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000809
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 545-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000336
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 635-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000131
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 588-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000811
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 7 Region: 790-814
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000919
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039132   Gene: ENSBTAG00000011646   Transcript: ENSBTAT00000039336
Sequence length 896
Comment pep:known_by_projection chromosome:UMD3.1:13:54353902:54359471:1 gene:ENSBTAG00000011646 transcript:ENSBTAT00000039336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSGGGIKGSPFSEMTDPFCVGGGRRVPGSSRSGPGKDGSRNEVRLPVLHEPPKLGLPVV
RAGQTVPSQAALCFDLESPAGDRTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRV
KCPNAGCWLEFPSIYGLKYHYQRCQGGAISERLTFPCPFCEAAFTSKTQLEKHRIWNHMD
RPLPAPKPGPVSRPVTVSRPVGVSKPIGVSKPVTISKPIGISKPVTVSRPVPVSKPVTVS
RPVPVTKPVTISRPVPVTKAVPPVTVNKPVPVTKPVTINKSVPMTKLVTVTKPVPVAKPV
TVSRPIVVSKPVTVSRPIAISRHTPPCKVVLLTKSENKAPRAAGRSSGKKRTADGLDTCP
IPPKHARPENGEYGPATPEQSSAFQLSTDPSSSPLSLGSRPSGGKEVPRAPGPGSPPEEG
AERVKHRRKQKTPKKFTGEQPSISGTFGLKGLAKAEDKARIHRAKKQEGPGPEDTRKKGP
APTSAVSKEVPAPMTHPAPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQ
KLQDALKCQHCRKQFKSKAGLNYHTMAEHSTKPSDAEASEGSEQEERERLRKVLKQMGRL
RCPQEGCGAAFSSLMGYQYHQRRCGKPPCEVETPSFPCTHCGKPYRSKAGHDYHVRSEHT
APPPEEPSDKASEAEDPLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDD
LVPETARLNYTRPGLPVLNPELLEAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASC
SKGDHLVGKYCCLLCPKEFSSESGVKYHILKTHAENWFRTSADPPPRHKGVDSPVPRKEK
SPASGKKRGRKPKERPSEEPAPGTPPHQDDWPPAGRDKGARGSTGRKVGAGKAPEK
Download sequence
Identical sequences E1BP84
ENSBTAP00000039132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]